Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.91
PubTator Score 2.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Pathway (1)

Gene RIF (4)

PMID Text
25690892 Data indicate transcription elongation factor (TEFM) as an essential component of the mitochondrial transcription machinery.
25635099 study found interaction of TEFM with mitochondrial RNA polymerase and nascent transcript prevents generation of replication primers and increases transcription processivity and serves as a molecular switch between replication and transcription, which appear to be mutually exclusive processes in mitochondria
21278163 The TEFM protein is proposed to be a critical component of the transcription apparatus of human mitochondria.
19291764 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGSVLFTAGERWRCFLTPSRSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ      1 - 70
ASILHVLNTASTKELEAFRLLRGRRSINIVEHRENFGPFQNLESLMNVPLFKYKSTVQVCNSILCPKTGR     71 - 140
EKRKSPENRFLRKLLKPDIERERLKAVNSIISIVFGTRRIAWAHLDRKLTVLDWQQSDRWSLMRGIYSSS    141 - 210
VYLEEISSIISKMPKADFYVLEKTGLSIQNSSLFPILLHFHIMEAMLYALLNKTFAQDGQHQVLSMNRNA    211 - 280
VGKHFELMIGDSRTSGKELVKQFLFDSILKADPRVFFPSDKIVHYRQMFLSTELQRVEELYDSLLQAIAF    281 - 350
YELAVFDSQP                                                                351 - 360
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25690892 2015 TEFM is a potent stimulator of mitochondrial transcription elongation in vitro.
25635099 2015 Mitochondrial biology. Replication-transcription switch in human mitochondria.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21278163 2011 TEFM (c17orf42) is necessary for transcription of human mtDNA.
21269460 2011 Initial characterization of the human central proteome.
19291764 2009 RNF135 mutations are not present in patients with Sotos syndrome-like features.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11468690 2001 Molecular characterization and gene content of breakpoint boundaries in patients with neurofibromatosis type 1 with 17q11.2 microdeletions.
10843809 2000 A common set of at least 11 functional genes is lost in the majority of NF1 patients with gross deletions.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.