Property Summary

NCBI Gene PubMed Count 0
PubMed Score 3.27
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6514 3.5e-12
Breast cancer 3469 4.6e-04
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 268 0.0 1.3

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.100 4.6e-04
psoriasis 1.100 3.5e-12

AA Sequence

MILKGCLLYPLCSPRNKQRCARLWKIAYGGLLKIVTGSLLTFYVVLCLDGGMVLMRKQVPSRFMYPKEWQ      1 - 70
HLTMFILLTLNGCVDFMSKNVLPQRCVGLEKGTLVLIIYELLLLMVSHVKDSEGVELHVYSLLILVVFLL     71 - 140
LLVLTAELWAPNMCHLQLMETFLILMMGSWLMQAGFILYRPVSGYPWQDDDISDIMFVTTFFCWHVMINA    141 - 210
SFLLGIYGFSSFWYHCFRPSLKLTGPKEAPYYASTPGPLYKLLQEVEQSEKEDQALLLPKSSP           211 - 273
//

Text Mined References (1)

PMID Year Title