Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.08
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 7.5e-09
ependymoma -1.200 2.4e-07
glioblastoma -1.600 1.3e-05
intraductal papillary-mucinous carcinoma... 1.100 9.0e-03
medulloblastoma -1.100 2.3e-03
medulloblastoma, large-cell -1.800 3.4e-05
osteosarcoma -1.859 8.3e-06
ovarian cancer 1.800 8.1e-08
pediatric high grade glioma -1.100 1.6e-04
primary Sjogren syndrome -1.200 3.9e-02

Gene RIF (1)

AA Sequence

MPNSVLWAVDLFGRVYTLSTAGQYWEMCKDSQLEFKRVSATTQCCWGIACDNQVYVYVCASDVPIRRREE      1 - 70
AYENQRWNPMGGFCEKLLLSDRWGWSDVSGLQHRPLDRVALPSPHWEWESDWYVDENFGGEPTEKGGWTY     71 - 140
AIDFPATYTKDKKWNSCVRRRKWIRYRRYKSRDIWAKIPSKDDPKELPDPFNDLSVGGWEITEEPVGRLS    141 - 210
VWAVSLQGKVWYREDVSHSNPEGSSWSLLDTPGEVVQISCGPHDLLWATLWEGQALVREGINRSNPKGSS    211 - 280
WSIVEPPGSENGVMHISVGVSVVWAVTKDWKVWFRRGVNSHNPCGTSWIEMVGEMTMVNVGMNDQVWGIG    281 - 350
CEDRAVYFRQGVTPSELSGKTWKAIIAARECDRSHSGSSSSLLSAGCFFGDEVRGSGESAPSDTDASSEV    351 - 420
ERPGPGQILPAEPLDDSKNATGNSASGLGAGRTAEDTVEDACPAEGSREARPNTHPGPAPTPAELPWTNI    421 - 490
DLKEAKKVPSHSAAGFPETTSLSSLGLLPLGLEEPYGVDDHPLWAWVSGGGCVVEACAMPRWFTVQAGLS    491 - 560
SSVHMLSLSITPAQTAAWRKQIFQQLTERTKRELENFRHYEQAVEQSVWVKTGALQWWCDWKPHKWVDVR    561 - 630
LALEQFTGHDGVRDSILFIYYVVHEEKKYIHIFLNEVVALVPVLNETKHSFALYTPERTRQRWPVRLAAA    631 - 700
TEQDMNDWLALLSLSCCESRKVQGRPSPQAIWSITCKGDIFVSEPSPDLEAHEHPLPCDQMFWRQMGGHL    701 - 770
RMVEANSRGVVWGIGYDHTAWVYTGGYGGGCFQGLASSTSNIYTQSDVKCVHIYENQRWNPVTGYTSRGL    771 - 840
PTDRYMWSDASGLQECTKAGTKPPSLQWAWVSDWFVDFSVPGGTDQEGWQYASDFPASYHGSKTMKDFVR    841 - 910
RRCWARKCKLVTSGPWLEVPPIALRDVSIIPESPGAEGSGHSIALWAVSDKGDVLCRLGVSELNPAGSSW    911 - 980
LHVGTDQPFASISIGACYQVWAVARDGSAFYRGSVYPSQPAGDCWYHIPSPPRQRLKQVSAGQTSVYALD    981 - 1050
ENGNLWYRQGITPSYPQGSSWEHVSNNVCRVSVGPLDQVWVIANKVQGSHSLSRGTVCHRTGVQPHEPKG   1051 - 1120
HGWDYGIGGGWDHISVRANATRAPRSSSQEQEPSAPPEAHGPVCC                            1121 - 1165
//

Text Mined References (13)

PMID Year Title