Property Summary

NCBI Gene PubMed Count 55
PubMed Score 9.12
PubTator Score 60.84

Knowledge Summary

Patent (122,028)

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.200 6.2e-14

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (19)

PMID Text
24722985 These results provide the first evidence that Nef interacts with cytoplasmic tyrosine kinases of the Tec family and suggest that Nef provides a mechanistic link between HIV-1 and Itk signaling in the viral life cycle.
24722985 A cell-based bimolecular fluorescence complementation assay demonstrates that HIV-1 Nef interacts with the Tec family members Bmx, Btk, and Itk but not Tec or Txk. Mutation A96I in the Tec SH3 domain dramatically enhances interaction with Nef
23260110 A cell-based bimolecular fluorescence complementation assay demonstrates that HIV-1 Nef interacts with the Tec family members Bmx, Btk, and Itk but not Tec or Txk. Mutation A96I in the Tec SH3 domain dramatically enhances interaction with Nef
22581839 results suggest that the oncogenic effect of the t(3;9) translocation may be due to the TFG-TEC chimeric protein and that fusion of the TFG (NTD) to the TEC protein produces a gain-of-function chimeric product
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20230531 Tec kinase has a crucial role in regulating FGF2 secretion under various physiological conditions
19913121 Observational study of gene-disease association. (HuGE Navigator)
19883687 inhibits CD25 expression in human T-lymphocytes
19393603 LPS-induced actin polymerization as well as MCP-1, tumor necrosis factor-alpha, interleukin-6, and interleukin-1beta expression are dependent on Tec kinase activity.
18564921 Observational study of gene-disease association. (HuGE Navigator)
18512796 Tec is the principal kinase of the Tec family that plays a major role in the responses of human neutrophils to monosodium urate crystals, which are likely to be involved in the initiation and perpetuation of gout
18171525 Overexpression of Tec is associated with the tumorigenesis and development of liver cancer.
15492005 SHIP1 and SHIP2 interact preferentially with Tec and inactivate it by de-phosphorylation of local PtdIns 3,4,5-P(3) and inhibition of Tec membrane localization
15184383 Btk/Tec kinases control sustained calcium signaling via site-specific phosphorylation of key residues within the phospholipase C gamma2 SH2-SH3 linker
14993283 Tec overexpression in lymphocyte cell lines is sufficient to induce phospholipase Cgamma (PLC-gamma) phosphorylation and NFAT (nuclear factor of activated T cells) activation.
12573241 specificity in tyrosine phosphorylation of SH3 domains in vitro is high and, therefore, SH3 domain phosphorylation is required for a distinct function in signaling
12049818 The AF2 domain of the orphan nuclear receptor is essential for the transcriptional activity of the oncogenic fusion protein EWS
11940595 Chemotactic factor-induced recruitment and activation of Tec family kinases in human neutrophils

AA Sequence

MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDG      1 - 70
VIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLA     71 - 140
PGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILE    141 - 210
KNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGL    211 - 280
YTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGK    281 - 350
NAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL    351 - 420
THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDL    421 - 490
AARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFT    491 - 560
EGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLRTIDELVECEETFG    561 - 630
R//

Text Mined References (60)

PMID Year Title
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24722985 2014 The accessory factor Nef links HIV-1 to Tec/Btk kinases in an Src homology 3 domain-dependent manner.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22581839 2012 The TFG-TEC fusion gene created by the t(3;9) translocation in human extraskeletal myxoid chondrosarcomas encodes a more potent transcriptional activator than TEC.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20230531 2010 Tec-kinase-mediated phosphorylation of fibroblast growth factor 2 is essential for unconventional secretion.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19883687 2010 Tec protein tyrosine kinase inhibits CD25 expression in human T-lymphocyte.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19393603 2009 Tec kinases regulate actin assembly and cytokine expression in LPS-stimulated human neutrophils via JNK activation.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
18564921 2008 Candidate gene analysis in primary lymphedema.
18512796 2008 Crystal-induced neutrophil activation: X. Proinflammatory role of the tyrosine kinase Tec.
18171525 2007 [The expression of Tec and the level of its phosphorylation in primary hepatic carcinomas].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15492005 2004 SHIP family inositol phosphatases interact with and negatively regulate the Tec tyrosine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184383 2004 Tec kinases mediate sustained calcium influx via site-specific tyrosine phosphorylation of the phospholipase Cgamma Src homology 2-Src homology 3 linker.
14993283 2004 Expression and function of Tec, Itk, and Btk in lymphocytes: evidence for a unique role for Tec.
14614854 2003 BTK regulates PtdIns-4,5-P2 synthesis: importance for calcium signaling and PI3K activity.
12573241 2003 Identification of phosphorylation sites within the SH3 domains of Tec family tyrosine kinases.
12515866 2003 Galpha 12 activates Rho GTPase through tyrosine-phosphorylated leukemia-associated RhoGEF.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445832 2002 Phosphorylation of Bruton's tyrosine kinase by c-Abl.
12049818 2002 The AF2 domain of the orphan nuclear receptor TEC is essential for the transcriptional activity of the oncogenic fusion protein EWS/TEC.
11825908 2002 Phosphatidylinositol 3-kinase and Src family kinases are required for phosphorylation and membrane recruitment of Dok-1 in c-Kit signaling.
11716489 2001 Isoform-dependent interaction of BRDG1 with Tec kinase.
11598012 2001 PKCbeta modulates antigen receptor signaling via regulation of Btk membrane localization.
11489907 2001 Sak serine-threonine kinase acts as an effector of Tec tyrosine kinase.
11328862 2001 Activation and association of the Tec tyrosine kinase with the human prolactin receptor: mapping of a Tec/Vav1-receptor binding site.
11071635 2000 Stem cell factor induces phosphatidylinositol 3'-kinase-dependent Lyn/Tec/Dok-1 complex formation in hematopoietic cells.
11013262 2000 Protein-tyrosine phosphatase D1, a potential regulator and effector for Tec family kinases.
10823839 2000 Mediation by the protein-tyrosine kinase Tec of signaling between the B cell antigen receptor and Dok-1.
10795735 2000 Tec kinases: a family with multiple roles in immunity.
10647781 Tec family of protein-tyrosine kinases: an overview of their structure and function.
10518561 1999 Molecular cloning of a docking protein, BRDG1, that acts downstream of the Tec tyrosine kinase.
10382746 1999 Tec kinase is involved in transcriptional regulation of IL-2 and IL-4 in the CD28 pathway.
9872994 1999 The role of Tec protein-tyrosine kinase in T cell signaling.
9753425 1998 Grb10/GrbIR as an in vivo substrate of Tec tyrosine kinase.
9652744 1998 Tec is involved in G protein-coupled receptor- and integrin-mediated signalings in human blood platelets.
9473212 1998 Tec and Jak2 kinases cooperate to mediate cytokine-driven activation of c-fos transcription.
9446655 1998 Expression and activation of the nonreceptor tyrosine kinase Tec in human B cells.
9341160 1997 SOCS-1/JAB/SSI-1 can bind to and suppress Tec protein-tyrosine kinase.
9299487 1997 Integrin-dependent tyrosine phoshorylation and cytoskeletal translocation of Tec in thrombin-activated platelets.
9178903 1997 Tec tyrosine kinase links the cytokine receptors to PI-3 kinase probably through JAK.
8892607 1996 Evidence that the Wiskott-Aldrich syndrome protein may be involved in lymphoid cell signaling pathways.
8632917 1996 Human Txk: genomic organization, structure and contiguous physical linkage with the Tec gene.
8630736 1996 Regulation of Btk function by a major autophosphorylation site within the SH3 domain.
8629002 1996 Activation of BTK by a phosphorylation mechanism initiated by SRC family kinases.
8621063 1996 Tec protein-tyrosine kinase is an effector molecule of Lyn protein-tyrosine kinase.
7934162 1994 Molecular cloning and analysis of the human Tec protein-tyrosine kinase.
7651724 1995 Interleukin 3 and erythropoietin induce association of Vav with Tec kinase through Tec homology domain.
7526158 1994 Tec kinase associates with c-kit and is tyrosine phosphorylated and activated following stem cell factor binding.
2284097 1990 A novel protein-tyrosine kinase, tec, is preferentially expressed in liver.