Property Summary

NCBI Gene PubMed Count 54
PubMed Score 46.15
PubTator Score 26.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 2.5e-03
Breast cancer 1.400 1.3e-09
colon cancer 1.400 2.4e-04
gastric carcinoma 2.100 2.8e-02
glioblastoma 1.200 8.6e-03
group 3 medulloblastoma 1.100 3.4e-02
interstitial cystitis 1.400 3.1e-05
intraductal papillary-mucinous adenoma (... -1.400 7.3e-04
intraductal papillary-mucinous carcinoma... -1.100 7.7e-03
lung cancer 1.200 9.4e-03
malignant mesothelioma 2.000 9.1e-08
medulloblastoma, large-cell 1.700 7.6e-04
osteosarcoma -1.063 1.5e-02
pediatric high grade glioma 1.600 1.7e-03
ulcerative colitis 1.100 9.5e-06

Protein-protein Interaction (11)

Gene RIF (35)

AA Sequence

MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSD      1 - 70
EGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIIS     71 - 140
ATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPP    141 - 210
APPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGG    211 - 280
LKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYA    281 - 350
RYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSAS    351 - 420
EHGAQHHIYRLVKE                                                            421 - 434
//

Text Mined References (58)

PMID Year Title