Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Seminoma 15 4.28 2.1

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSA      1 - 70
FPGLGSLGGQDSSGSLVQRASCELESPYEL                                             71 - 100
//

Text Mined References (2)

PMID Year Title
22123530 2011 Characterization of a novel human testis-specific gene: testis developmental related gene 1 (TDRG1).
14574404 2003 The DNA sequence and analysis of human chromosome 6.