Property Summary

Ligand Count 41
NCBI Gene PubMed Count 33
PubMed Score 56.62
PubTator Score 47.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis -1.126 1.4e-02
acute quadriplegic myopathy 1.358 5.4e-05
breast carcinoma 1.500 8.3e-03
colon cancer -2.100 4.8e-04
dermatomyositis 1.500 2.5e-03
juvenile dermatomyositis 1.426 4.8e-10
medulloblastoma, large-cell -1.800 5.8e-06
Multiple myeloma 1.510 1.1e-02
ovarian cancer -2.100 1.4e-05
Waldenstrons macroglobulinemia 1.426 3.6e-03

Gene RIF (25)

AA Sequence

MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESA      1 - 70
LERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYL     71 - 140
ALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTKMMRNLLC    141 - 210
VHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNI    211 - 280
VDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD    281 - 350
HWGLLCNLDIIL                                                              351 - 362
//

Text Mined References (40)

PMID Year Title