Property Summary

Ligand Count 18
NCBI Gene PubMed Count 36
PubMed Score 773.56
PubTator Score 301.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (24)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.269 1.0e-04
astrocytic glioma -1.100 1.9e-02
Breast cancer 2.000 7.0e-05
breast carcinoma 1.100 1.0e-17
cutaneous lupus erythematosus 4.000 1.1e-04
ductal carcinoma in situ 3.200 3.9e-03
gastric carcinoma 2.400 3.7e-02
head and neck cancer and chronic obstruc... 2.300 1.1e-03
interstitial cystitis 3.500 2.1e-04
invasive ductal carcinoma 3.100 1.8e-04
lung adenocarcinoma 1.700 1.2e-07
malignant mesothelioma 2.100 3.1e-07
medulloblastoma -1.300 3.4e-03
non-small cell lung cancer 1.499 2.2e-05
oligodendroglioma -1.300 2.5e-02
ovarian cancer 2.900 4.2e-03
pancreatic ductal adenocarcinoma liver m... -2.992 3.1e-02
periodontitis 1.400 4.7e-23
pituitary cancer -2.800 6.3e-06
primary Sjogren syndrome 1.100 2.5e-03
primitive neuroectodermal tumor -1.400 1.2e-02
psoriasis 2.600 7.8e-47
spina bifida -2.227 3.6e-02
ulcerative colitis 2.300 1.1e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEH      1 - 70
LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDF     71 - 140
NDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLE    141 - 210
RTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKG    211 - 280
ERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHY    281 - 350
LRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD                  351 - 406
//

Text Mined References (37)

PMID Year Title