Property Summary

NCBI Gene PubMed Count 31
PubMed Score 106.20
PubTator Score 301.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 2.100 3.1e-07
astrocytic glioma -1.100 1.9e-02
oligodendroglioma -1.300 2.5e-02
cutaneous lupus erythematosus 4.000 1.1e-04
periodontitis 1.400 4.7e-23
medulloblastoma -1.300 3.4e-03
primitive neuroectodermal tumor -1.400 1.2e-02
Amyotrophic Lateral Sclerosis 1.269 1.0e-04
pancreatic ductal adenocarcinoma liver m... -2.992 3.1e-02
non-small cell lung cancer 1.499 2.2e-05
interstitial cystitis 4.400 1.3e-05
lung adenocarcinoma 1.700 1.2e-07
primary Sjogren syndrome 1.100 2.5e-03
breast carcinoma 1.100 1.0e-17
spina bifida -2.227 3.6e-02
Breast cancer 2.000 7.0e-05
gastric carcinoma 2.400 3.7e-02
ductal carcinoma in situ 3.200 3.9e-03
invasive ductal carcinoma 3.100 1.8e-04
ulcerative colitis 2.300 1.1e-02
ovarian cancer 2.900 4.2e-03
pituitary cancer -2.800 6.3e-06
head and neck cancer and chronic obstruc... 2.300 1.1e-03
psoriasis 2.600 7.8e-47

Protein-protein Interaction (2)

Gene RIF (16)

PMID Text
25066423 Crystal tryptophan 2,3-dioxygenase structure revealed eight residues playing critical roles in L-tryptophan oxidation.
24974860 IL-1beta is suggested to stimulate tryptophan catabolism and production of IL-6 and IL-8 by increasing TDO expression in endometriosis.
23630570 TDO is highly expressed in the brains of Alzheimer disease patients.
23558111 Identification of 12 polymorphisms in the human TDO2 promoter region, 2 of them corresponding to previously unknown single-nucleotide polymorphisms and 3 of them located in putative glucocorticoid-responsive elements.
22082147 Data suggest that T342 in hTDO has critical role in controlling substrate binding, substrate stereoselectivity, H-bonding interaction between enzyme and intermediates, and regulating the dynamics of protein structure.
21892828 The data suggest that TDO uses a ring-opening mechanism during N-formylkynurenine formation, rather than Criegee or dioxetane mechanisms as previously proposed.
21361337 Studies indicate that the heme dioxygenases are differentiated by their ability to catalyze the oxidation of l-tryptophan to N-formylkynurenine.
20361220 subtle differences between the TDO and IDO reactions
19637229 TDO mediates antimicrobial and immunoregulatory effects. TDO-dependent inhibition of T-cell growth might be involved in the immunotolerance observed in vivo during allogeneic liver transplantation.
19502010 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19218188 The tyrosine 42 of recombinant human TDO is responsible for the cooperative binding of l-Trp by participating in the active site of the adjacent subunit.
18370401 significant mechanistic differences exist across the heme dioxygenase family, and the data are discussed within this broader framework
15390107 We found that astrocytes, neurons, and microglia expressed IDO but only microglia were able to produce detectable amounts of quinolinic acid. However, astrocytes and neurons had the ability to catabolize quinolinic acid.
14755447 Polymorphism of tryptophan 2,3 dioxygenase gene is associated with autism.
12634647 The activity and mRNA expression level of indoleamine 2,3-dioxygenase in term placentas were significantly lower in preeclampsia. Could cause dysregulation of inflammatory response intrinsic to normal pregnancy.
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEH      1 - 70
LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDF     71 - 140
NDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLE    141 - 210
RTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKG    211 - 280
ERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHY    281 - 350
LRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD                  351 - 406
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25066423 2014 Structural and functional analyses of human tryptophan 2,3-dioxygenase.
24974860 2014 IL-1? increases expression of tryptophan 2,3-dioxygenase and stimulates tryptophan catabolism in endometrioma stromal cells.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23630570 2013 Expression of tryptophan 2,3-dioxygenase and production of kynurenine pathway metabolites in triple transgenic mice and human Alzheimer's disease brain.
23558111 Characterization of functional polymorphisms and glucocorticoid-responsive elements in the promoter of TDO2, a candidate gene for ethanol-induced behavioural disorders.
22308364 2012 Reversal of tumoral immune resistance by inhibition of tryptophan 2,3-dioxygenase.
22082147 2011 Molecular basis for the substrate stereoselectivity in tryptophan dioxygenase.
21976023 2011 An endogenous tumour-promoting ligand of the human aryl hydrocarbon receptor.
21892828 2011 The mechanism of formation of N-formylkynurenine by heme dioxygenases.
21361337 2011 Structure and reaction mechanism in the heme dioxygenases.
20361220 2010 The first step of the dioxygenation reaction carried out by tryptophan dioxygenase and indoleamine 2,3-dioxygenase as revealed by quantum mechanical/molecular mechanical studies.
19786962 2011 First genome-wide association scan on neurophysiological endophenotypes points to trans-regulation effects on SLC2A3 in dyslexic children.
19637229 2009 Antimicrobial and immunoregulatory properties of human tryptophan 2,3-dioxygenase.
19502010 2009 Two complex genotypes relevant to the kynurenine pathway and melanotropin function show association with schizophrenia and bipolar disorder.
19218188 2009 Cooperative binding of L-trp to human tryptophan 2,3-dioxygenase: resonance Raman spectroscopic analysis.
18370401 2008 A kinetic, spectroscopic, and redox study of human tryptophan 2,3-dioxygenase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16892178 2006 Differentiation of human embryonic stem cells into hepatocytes in 2D and 3D culture systems in vitro.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15390107 2005 Expression of indoleamine 2,3-dioxygenase and production of quinolinic acid by human microglia, astrocytes, and neurons.
14755447 2004 Association of tryptophan 2,3 dioxygenase gene polymorphism with autism.
14704851 2004 Enzymology of NAD+ homeostasis in man.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12634647 2003 Decreased tryptophan catabolism by placental indoleamine 2,3-dioxygenase in preeclampsia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11469796 2001 Structure--function relationships of rat hepatic tryptophan 2,3-dioxygenase: identification of the putative heme-ligating histidine residues.
11140838 2000 A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory.
8666386 1995 Sequence of human tryptophan 2,3-dioxygenase (TDO2): presence of a glucocorticoid response-like element composed of a GTT repeat and an intronic CCCCT repeat.
2004780 1991 Human tryptophan oxygenase localized to 4q31: possible implications for alcoholism and other behavioral disorders.