Property Summary

NCBI Gene PubMed Count 80
PubMed Score 156.30
PubTator Score 75.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (58)

PMID Text
26375669 Cripto-1 overexpression contributes to aggressiveness and poor prognosis of hepatocellular carcinoma
26343543 Cripto-1 is a novel and dynamically regulated effector of stem cell functions in colorectal cancer.
26327334 The main signaling pathways mediating Cripto-1 effects include Nodal-dependent (Smad2/3) and Nodal-independent (Src/p44/42/Akt) signaling transduction pathways
26109366 serum CR-1 is a useful diagnostic and prognostic marker for nonsmall cell lung cancer patients.
25889638 Snail represses Cripto-1 gene by direct transcriptional interaction
25796148 Over expression of Cripto-1 was correlated with the occurrence, development, metastasis and malignant degree of lung adenocarcinoma.
25658584 Treatment of U-87 MG cells with CR-1 leads to higher expression of drug efflux protein MDR-1 in the CR-1 positive subpopulation, indicating correlated induction of these two proteins.
25629528 the functional analysis of the main associated locus identified a causal variant in the 5'UTR of CRIPTO gene which is able to strongly modulate CRIPTO expression through an AP-1-mediate transcriptional regulation.
25596738 these findings suggest a novel molecular network, involving CRIPTO, AKT, and FGFR signaling, in favor of the emergence of mesenchymal-like cancer cells during the development of aggressive prostate tumors.
25326807 Our findings suggest that high Cripto-1 expression might be involved in the development of bladder cancer and a potentially effective prognostic marker in bladder cancer patients
25228630 Report lower gene expression of Cripto in endometriosis but difference not maintained at protein level.
25165718 This study demonstrated CR-1 expression in the placental bed, its increased expression in creta placentas, and EVT cells as the main CR-1-producing cell type.
24911146 Tumors from NSCLC patients with EGFR-activating mutations that were intrinsically resistant to EGFR-TKIs expressed higher levels of CRIPTO1 compared with tumors from patients that were sensitive to EGFR-TKIs.
24870591 Data suggest that the high expression of Cripto-1 (CR-1) may play an important role in the progression of non-small cell lung cancer (NSCLC), and CR-1 expression may offer a valuable marker for predicting the outcome of patients with NSCLC.
24749068 these findings identify the CRIPTO/GRP78 pathway as a developmentally conserved regulator of fetal and adult mammary stem cell behavior ex vivo, with implications for the stem-like cells found in many cancers.
24521322 CR-1 expression in glioblastoma multiforme(GBM)tissue and blood; CR-1 plasma levels from GBM patients were elevated compared with normal; CR-1 concentrations higher than normal correlated with shorter overall survival; identified CR-1 in different areas of GBM tissue including perivascular tumor cells and endothelial cells
24500260 These findings clearly suggest that the downregulation of miR-15a-16 with Cripto amplification may be involved in the development of nonsmall cell lung cancer.
24379580 Cripto is overexpressed in colonic neoplasms and is related to cancer cell migration/invasion.
23574716 The significance of cell surface CR-1 expression in human melanoma cells, was examined.
23129342 Offer some insight into the transcriptional regulation of CR-1 gene expression and its critical role in the pathogenesis of human cancer.
23034635 human testicular tumors showed upregulation of NODAL and CRIPTO that was proportional to invasiveness and to the number of malignant cells.
23022962 Cross-talk between Cripto-1 and the Wnt/beta-catenin signaling pathway might play a role in mammary transformation leading to a more aggressive behavior of mammary cancer cells.
22542493 Cripto-1 may play a role during developmental EMT, and it may also be involved in the reprogramming of differentiated tumor cells into cancer stem cells through the induction of an EMT program.
22306319 Cripto/GRP78 modulates the TGF-beta pathway in development and oncogenesis [review]
21863025 High CRIPTO-1 is associated with cutaneous melanoma.
21824804 Cripto-1 plays a role in the malignant transformation of oral mucosa and is involved in the tumorigenesis and progression of oral squamous cell carcinoma by promoting the growth and migration of malignant cells.
21496809 Disturbed expression of endometrial activin A, cripto , and follistatin suggests a dysfunction of the activin pathway in endometriosis/endometrioma.
21055389 expression of CR-1 may alter the physiochemical properties of the plasma membrane resulting in an enhancement of intercellular transfer of cellular signaling components which may account for the paracrine activity of CR-1.
20629020 molecular model of activin receptor-like kinase 4/Cripto/Nodal complex built by homology modeling as well as docking tests aimed at identifying potential binding epitopes
20549704 Results demonstrate that CR-1 expression is enriched in an undifferentiated, tumorigenic subpopulation and is regulated by key regulators of pluripotent stem cells.
20385969 TDGF-1, which is significantly upregulated in APA and mediates aldosterone hypersecretion and deregulated growth in adrenocortical cells in vitro, may represent a key player in the development and pathophysiology of primary aldosteronism.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20128024 Data suggest that the up-regulation of CR-1 and p-STAT3 may play important roles in gastric carcinogenesis and lymph node metastasis
20126975 TDGF1 has a role in metachronous metastasis of colorectal cancer
19874624 Nodal and Cripto immunoreactivity increased dramatically in the transition from histologic Grade 1 to histologic Grades 2 and 3 endometrial carcinomas.
19853938 work firstly provides human genetic evidence of TDGF1 involved in the pathogenesis of ventricular septal defects
19853938 Observational study of gene-disease association. (HuGE Navigator)
19732464 Cripto-1 overexpression is connected with the tumorigenesis and progression of nasopharyngeal carcinoma.
19727905 Observational study of gene-disease association. (HuGE Navigator)
19421146 Results show that targeted disruption of the cell surface Cripto/GRP78 complex precludes Cripto activation of MAPK/PI3K and Smad2/3 pathways.
19386982 Activin A, activin receptor type II, nodal, and cripto mRNA are expressed by eutopic and ectopic endometrium in women with ovarian endometriosis.
19082438 Cripto-1 overexpression is involved in the tumorigenesis of gastric- and pancreatobiliary-type intraductal papillary mucinous neoplasms
19035567 Study indicate that the synthetic h-CFC interacts with the ALK4 receptor with a K(D) in micro M range, that the h-CFC overall topology is determined by the presence of three disulfide bridges.
18312357 Combined analysis of Cripto-1 and E-cadherin has significant value in evaluating the metastatic potential of gastric cancer and predicting patient prognosis.
18089557 Cripto facilitates Nodal signaling and inhibits activin signaling by forming receptor complexes with these ligands that are structurally and functionally similar.
17941089 Tese results suggest a differential modulation of CR-1 gene expression in embryonal and colon cancer cells by two different members of the TGF-beta family.
17925387 GPI attachment of CR-1 is required for the paracrine activity as a Nodal co-receptor.
17720976 Growth factor induction of Cripto-1 shedding by glycosylphosphatidylinositol-phospholipase D and enhancement of endothelial cell migration are reported.
17291450 Transcriptional regulation of CR-1 expression by WNT signaling through an intronic-exonic enhancer element, containing three tandem TCF/LEF binding sites within the CR-1 gene.
17030617 Cripto inhibits the tumor suppressor function of TGF-beta by a novel mechanism.
16954206 CRIPTO-3, a processed pseudogene of CRIPTO-1 on the X chromosome, is expressed in undifferentiated NT2 cells and is regulated by germ cell nuclear factor in parallel to CRIPTO-1
16951234 The plasma CR-1 might represent a novel biomarker for the detection of breast and colon carcinomas. A statistically significant increase in the levels of plasma CR-1 was found in patients with colon carcinoma and in patients with breast carcinoma.
16176936 The regulation of Netrin-1 expression is important in regulating Cripto-1-dependent invasion and migration of mammary epithelial cells.
14584041 Results suggest that cripto-1 overexpression might be associated with the progression towards a more aggressive phenotype in breast carcinoma, through the activation of both Akt and Smad-2 signalling pathways.
14581455 CRIPTO signaling promotes cardiomyogenesis and redirects the neural fate of embryonic stem cells.
12682303 complexation with activin and type II activin receptors and role in blocking activin signaling
12073012 A loss-of-function mutation in the CFC domain of TDGF1 is associated with human forebrain defects.
12052855 Cripto has dual roles as a coreceptor as well as a coligand for Nodal and that this signaling interaction with Nodal is regulated by an unusual form of glycosylation.

AA Sequence

MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPM      1 - 70
GIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRC     71 - 140
FPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY                          141 - 188
//

Text Mined References (83)

PMID Year Title
26375669 2015 Elevated expression of Cripto-1 correlates with poor prognosis in hepatocellular carcinoma.
26343543 2015 Dynamic regulation of the cancer stem cell compartment by Cripto-1 in colorectal cancer.
26327334 2015 Cripto-1: an extracellular protein - connecting the sequestered biological dots.
26109366 2015 Serum cripto-1 as a clinical marker for lung cancer.
25889638 2015 Snail-mediated Cripto-1 repression regulates the cell cycle and epithelial-mesenchymal transition-related gene expression.
25796148 2015 Expression of Cripto-1 gene protein and Activin-A in human lung adenocarcinoma tissue.
25658584 2015 Autoregulation and heterogeneity in expression of human Cripto-1.
25629528 2015 Genetic variants modulating CRIPTO serum levels identified by genome-wide association study in Cilento isolates.
25596738 2015 CRIPTO overexpression promotes mesenchymal differentiation in prostate carcinoma cells through parallel regulation of AKT and FGFR activities.
25326807 2015 Cripto-1 expression and its prognostic value in human bladder cancer patients.
25228630 2015 Expression of Nodal, Cripto, SMAD3, phosphorylated SMAD3, and SMAD4 in the proliferative endometrium of women with endometriosis.
25165718 2014 Tumorigenic factor CRIPTO-1 is immunolocalized in extravillous cytotrophoblast in placenta creta.
24911146 2014 CRIPTO1 expression in EGFR-mutant NSCLC elicits intrinsic EGFR-inhibitor resistance.
24870591 2014 Elevated expression of Cripto-1 correlates with poor prognosis in non-small cell lung cancer.
24749068 2014 CRIPTO/GRP78 signaling maintains fetal and adult mammary stem cells ex vivo.
24521322 2014 Cripto-1 expression in glioblastoma multiforme.
24500260 2014 MiR-15a-16 represses Cripto and inhibits NSCLC cell progression.
24379580 2013 Clinicopathological and biological significance of cripto overexpression in human colon cancer.
23574716 2013 The significance of a Cripto-1 positive subpopulation of human melanoma cells exhibiting stem cell-like characteristics.
23129342 2013 Regulation of human Cripto-1 expression by nuclear receptors and DNA promoter methylation in human embryonal and breast cancer cells.
23034635 2012 Endogenous Nodal signaling regulates germ cell potency during mammalian testis development.
23022962 2013 Cripto-1 enhances the canonical Wnt/?-catenin signaling pathway by binding to LRP5 and LRP6 co-receptors.
22542493 2012 Role of Cripto-1 during epithelial-to-mesenchymal transition in development and cancer.
22306319 2012 Cripto/GRP78 modulation of the TGF-? pathway in development and oncogenesis.
21863025 2011 Expression and functional role of CRIPTO-1 in cutaneous melanoma.
21824804 2011 The role of Cripto-1 in the tumorigenesis and progression of oral squamous cell carcinoma.
21496809 2011 Altered expression of activin, cripto, and follistatin in the endometrium of women with endometrioma.
21055389 2010 Intercellular transfer regulation of the paracrine activity of GPI-anchored Cripto-1 as a Nodal co-receptor.
20629020 2010 Structural investigations on the Nodal-Cripto binding: a theoretical and experimental approach.
20549704 2010 Cripto-1 is a cell surface marker for a tumorigenic, undifferentiated subpopulation in human embryonal carcinoma cells.
20385969 2010 Teratocarcinoma-derived growth factor-1 is upregulated in aldosterone-producing adenomas and increases aldosterone secretion and inhibits apoptosis in vitro.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20128024 2010 Significance and relationship between Cripto-1 and p-STAT3 expression in gastric cancer and precancerous lesions.
20126975 2010 TDGF1 is a novel predictive marker for metachronous metastasis of colorectal cancer.
19874624 2009 Expression of nodal signalling components in cycling human endometrium and in endometrial cancer.
19853938 2011 Teratocarcinoma-derived growth factor 1 (TDGF1) sequence variants in patients with congenital heart defect.
19732464 2009 Cripto-1 overexpression is involved in the tumorigenesis of nasopharyngeal carcinoma.
19727905 2010 Common variants in FLNB/CRTAP, not ARHGEF3 at 3p, are associated with osteoporosis in southern Chinese women.
19421146 2009 Blockade of Cripto binding to cell surface GRP78 inhibits oncogenic Cripto signaling via MAPK/PI3K and Smad2/3 pathways.
19386982 2009 Activin A, activin receptor type II, nodal, and cripto mRNA are expressed by eutopic and ectopic endometrium in women with ovarian endometriosis.
19082438 2009 Cripto-1 overexpression is involved in the tumorigenesis of gastric-type and pancreatobiliary-type intraductal papillary mucinous neoplasms of the pancreas.
19035567 2009 Structural insights into the interaction between the Cripto CFC domain and the ALK4 receptor.
18930707 2008 Characterization of the glycosylphosphatidylinositol-anchor signal sequence of human Cryptic with a hydrophilic extension.
18835250 2008 CRIPTO3, a presumed pseudogene, is expressed in cancer.
18312357 2008 Positive association of up-regulated Cripto-1 and down-regulated E-cadherin with tumour progression and poor prognosis in gastric cancer.
18089557 2008 Cripto is a noncompetitive activin antagonist that forms analogous signaling complexes with activin and nodal.
17941089 2008 Regulation of human Cripto-1 gene expression by TGF-beta1 and BMP-4 in embryonal and colon cancer cells.
17925387 2007 Requirement of glycosylphosphatidylinositol anchor of Cripto-1 for trans activity as a Nodal co-receptor.
17720976 2007 Growth factor induction of Cripto-1 shedding by glycosylphosphatidylinositol-phospholipase D and enhancement of endothelial cell migration.
17291450 2007 beta-Catenin/TCF/LEF regulate expression of the short form human Cripto-1.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17030617 2006 Cripto binds transforming growth factor beta (TGF-beta) and inhibits TGF-beta signaling.
16954206 2006 Germ cell nuclear factor is a repressor of CRIPTO-1 and CRIPTO-3.
16951234 2006 Identification of cripto-1 as a novel serologic marker for breast and colon cancer.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16176936 2005 Netrin-1 regulates invasion and migration of mouse mammary epithelial cells overexpressing Cripto-1 in vitro and in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14584041 2004 Cripto-1 overexpression leads to enhanced invasiveness and resistance to anoikis in human MCF-7 breast cancer cells.
14581455 2003 Nodal-dependent Cripto signaling promotes cardiomyogenesis and redirects the neural fate of embryonic stem cells.
12925698 2003 Antibody blockade of the Cripto CFC domain suppresses tumor cell growth in vivo.
12919325 2003 The CRIPTO/FRL-1/CRYPTIC (CFC) domain of human Cripto. Functional and structural insights through disulfide structure analysis.
12682303 2003 Cripto forms a complex with activin and type II activin receptors and can block activin signaling.
12649175 2003 A Nodal- and ALK4-independent signaling pathway activated by Cripto-1 through Glypican-1 and c-Src.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12073012 2002 A loss-of-function mutation in the CFC domain of TDGF1 is associated with human forebrain defects.
12052855 2002 Dual roles of Cripto as a ligand and coreceptor in the nodal signaling pathway.
11909953 2002 Cripto-1 activates nodal- and ALK4-dependent and -independent signaling pathways in mammary epithelial Cells.
11857442 2002 Cripto: a tumor growth factor and more.
11485994 2001 The orphan receptor ALK7 and the Activin receptor ALK4 mediate signaling by Nodal proteins during vertebrate development.
10493495 1999 Cripto-1 induces phosphatidylinositol 3'-kinase-dependent phosphorylation of AKT and glycogen synthase kinase 3beta in human cervical carcinoma cells.
10393436 1999 Assignment of human teratocarcinoma derived growth factor (TDGF) sequences to chromosomes 2q37, 3q22, 6p25 and 19q13.1.
10070255 1999 Cripto: a novel epidermal growth factor (EGF)-related peptide in mammary gland development and neoplasia.
9876177 1999 Abrogation of the Cripto gene in mouse leads to failure of postgastrulation morphogenesis and lack of differentiation of cardiomyocytes.
9576836 1998 Specific arrest of cardiogenesis in cultured embryonic stem cells lacking Cripto-1.
9013573 1997 Cripto enhances the tyrosine phosphorylation of Shc and activates mitogen-activated protein kinase (MAPK) in mammary epithelial cells.
8543395 1996 Differential immunohistochemical detection of transforming growth factor alpha, amphiregulin and CRIPTO in human normal and malignant breast tissues.
8314343 1994 Cripto, a member of the epidermal growth factor family, is over-expressed in human pancreatic cancer and chronic pancreatitis.
8006041 1994 Identification and biological characterization of an epidermal growth factor-related protein: cripto-1.
7860072 1995 Regional localization of the human EGF-like growth factor CRIPTO gene (TDGF-1) to chromosome 3p21.
2792079 1989 Molecular characterization of a gene of the 'EGF family' expressed in undifferentiated human NTERA2 teratocarcinoma cells.
1882841 1991 Isolation and characterization of the CRIPTO autosomal gene and its X-linked related sequence.