Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.02
PubTator Score 5.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.2e-04
ependymoma 2.100 2.3e-02
glioblastoma 1.200 9.5e-04
lung cancer 1.100 2.5e-02
ovarian cancer -1.100 1.0e-05
subependymal giant cell astrocytoma 1.179 1.3e-02

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (7)

AA Sequence

MRPRGLPPLLVVLLGCWASVSAQTDATPAVTTEGLNSTEAALATFGTFPSTRPPGTPRAPGPSSGPRPTP      1 - 70
VTDVAVLCVCDLSPAQCDINCCCDPDCSSVDFSVFSACSVPVVTGDSQFCSQKAVIYSLNFTANPPQRVF     71 - 140
ELVDQINPSIFCIHITNYKPALSFINPEVPDENNFDTLMKTSDGFTLNAESYVSFTTKLDIPTAAKYEYG    141 - 210
VPLQTSDSFLRFPSSLTSSLCTDNNPAAFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILRVPDSRK    211 - 280
KVPITVQSIVIQSLNKTLTRREDTDVLQPTLVNAGHFSLCVNVVLEVKYSLTYTDAGEVTKADLSFVLGT    281 - 350
VSSVVVPLQQKFEIHFLQENTQPVPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQD    351 - 420
CLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQKVKSLLWGQGFPDYVAPFGNSQAQDMLDWVPIHF    421 - 490
ITQSFNRKDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTANLISSSFPEANSGNERTILISTAVTFVDV    491 - 560
SAPAEAGFRAPPAINARLPFNFFFPFV                                               561 - 587
//

Text Mined References (18)

PMID Year Title