Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.62
PubTator Score 4.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Hereditary hemorrhagic telangiectasia 13 4.609 2.3

Expression

Gene RIF (1)

AA Sequence

MASRPLPPGRQEEENAKDSGRKPSPVRPRGCLPSIDEARPAGPGPAPASRRGSMLGLAASFSRRNSLVGP      1 - 70
GAGPGGQRPSLGPVPPLGSRVSFSGLPLAPARWVAPSYRTEPVPGERWEAARAQRALEAALAAGLHDACY     71 - 140
SSDEAARLVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLF    141 - 210
AVATVHGLYCE                                                               211 - 221
//

Text Mined References (7)

PMID Year Title