Property Summary

NCBI Gene PubMed Count 13
PubMed Score 56.48
PubTator Score 35.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2844 1.2e-26
osteosarcoma 7933 6.5e-03
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
T-cell leukemia 4 3.982 2.0
Mowat-Wilson syndrome 12 3.118 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.018 6.5e-03
lung carcinoma 1.200 1.2e-26

Gene RIF (6)

PMID Text
22174563 TCTA protein has roles in lung cancer cell lines and human osteoclastogenesis [review]
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20046013 It expressed in synovial tissues from patients with RA and inhibits human osteoclastogenesis. (review)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19560569 TCTA is a novel protein expressed in synovial tissues of rheumatoid arthritis that regulate human osteoclastogenesis.

AA Sequence

MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHR      1 - 70
PGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE                                          71 - 103
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22174563 2012 The role of T-cell leukemia translocation-associated gene protein in human tumorigenesis and osteoclastogenesis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20046013 2009 [Role of T-cell leukemia translocation-associated gene (TCTA) protein in human osteoclastogenesis].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19560569 2009 T-cell leukemia translocation-associated gene (TCTA) protein is required for human osteoclastogenesis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
7728759 1995 Cloning and characterization of TCTA, a gene located at the site of a t(1;3) translocation.