Property Summary

NCBI Gene PubMed Count 13
PubMed Score 59.69
PubTator Score 35.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2843 1.2e-26
osteosarcoma 7950 6.5e-03
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 2.2
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
T-cell leukemia 4 4.004 2.0
Mowat-Wilson syndrome 11 3.144 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.200 1.2e-26
osteosarcoma -1.018 6.5e-03

Gene RIF (6)

AA Sequence

MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHR      1 - 70
PGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE                                          71 - 103
//

Text Mined References (16)

PMID Year Title