Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.08
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.500 5.4e-03
ependymoma -2.000 3.9e-03
intraductal papillary-mucinous adenoma (... -1.100 5.7e-03
malignant mesothelioma -3.200 2.2e-08
medulloblastoma -1.100 3.0e-03
medulloblastoma, large-cell -1.200 8.7e-03
osteosarcoma -1.060 4.7e-05
ovarian cancer 1.300 5.7e-03

Gene RIF (1)

AA Sequence

MSENLDKSNVNEAGKSKSNDSEEGLEDAVEGADEALQKAIKSDSSSPQRVQRPHSSPPRFVTVEELLETA      1 - 70
RGVTNMALAHEIVVNGDFQIKPVELPENSLKKRVKEIVHKAFWDCLSVQLSEDPPAYDHAIKLVGEIKET     71 - 140
LLSFLLPGHTRLRNQITEVLDLDLIKQEAENGALDISKLAEFIIGMMGTLCAPARDEEVKKLKDIKEIVP    141 - 210
LFREIFSVLDLMKVDMANFAISSIRPHLMQQSVEYERKKFQEILERQPNSLDFVTQWLEEASEDLMTQKY    211 - 280
KHALPVGGMAAGSGDMPRLSPVAVQNYAYLKLLKWDHLQRPFPETVLMDQSRFHELQLQLEQLTILGAVL    281 - 350
LVTFSMAAPGISSQADFAEKLKMIVKILLTDMHLPSFHLKDVLTTIGEKVCLEVSSCLSLCGSSPFTTDK    351 - 420
ETVLKGQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRELEEVAIKFARLVNYN    421 - 490
KMVFCPYYDAILSKILVRS                                                       491 - 509
//

Text Mined References (12)

PMID Year Title