Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.77
PubTator Score 9.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Strongyloidiasis 9 3.27 1.6
Leukemia 88 3.089 1.5

Gene RIF (2)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
20228224 subcellular localization of activated AKT is dependent on TCL1B expression in estrogen receptor- and progesterone receptor-expressing breast cancer

AA Sequence

MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHT      1 - 70
RELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKD                 71 - 128
//

Text Mined References (12)

PMID Year Title
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20228224 2010 Subcellular localization of activated AKT in estrogen receptor- and progesterone receptor-expressing breast cancers: potential clinical implications.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707444 2002 Differential regulation of Akt kinase isoforms by the members of the TCL1 oncogene family.
11607815 2001 The role of TCL1 in human T-cell leukemia.
10983986 2000 The protooncogene TCL1 is an Akt kinase coactivator.
10851082 2000 Identification of the TCL6 genes within the breakpoint cluster region on chromosome 14q32 in T-cell leukemia.
10344735 1999 Identification of the TCL1/MTCP1-like 1 (TML1) gene from the region next to the TCL1 locus.
10077617 1999 Abnormalities at 14q32.1 in T cell malignancies involve two oncogenes.