Property Summary

NCBI Gene PubMed Count 74
PubMed Score 27.72
PubTator Score 131.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.204 1.2e-02
cutaneous lupus erythematosus 3.500 6.3e-04
psoriasis 3.300 3.1e-31
osteosarcoma -4.626 7.6e-08
tuberculosis and treatment for 3 months 2.900 4.8e-04
interstitial cystitis 2.100 2.1e-02
primary Sjogren syndrome 1.600 1.0e-03
nasopharyngeal carcinoma -1.800 4.2e-04
ulcerative colitis 1.700 3.4e-02

Gene RIF (57)

PMID Text
26493619 We investigated TCL1 expression at the protein level in the bone marrow of a series of 59 patients with Waldenstrom macroglobulinemia: 76% of patients expressed TCL1, which appeared to be associated with a pejorative prognostic impact.
26299617 Our results suggest that intratumoral TCL1A+ B cells are important for controlling cervical cancer development.
26090867 Suggest miR-181b as therapeutic target for chronic lymphocytic leukemia in the Emicro-TCL1 mouse model.
25936528 High TCL1A expression is associated with chronic lymphocytic leukemia.
25688912 Our study suggests that TCL1 expression profile may have a role in the prediction of overall outcome in patient with MCL and call for prospective studies.
25646413 demonstrated that miR-3676 targets three consecutive 28-bp repeats within 3'UTR of TCL1 and showed that miR-3676 is a powerful inhibitor of TCL1
25481307 Polymorphic genetic variations of cytochrome P450 19A1 and T-cell leukemia 1A genes in the Tamil population
25348018 Peptide-based TCL1-interphase mimics were potent in steric AKT antagonization.
25310835 Report frequent TCL1A rearrangements in T-cell prolymphocytic leukemia with cutaneous involvement.
24966976 Case Report: T-cell lymphoblastic leukemia/lymphoma with t(7;14)(p15;q32) [TCRgamma-TCL1A translocation] confirmed by FISH.
23608884 TCL1-Tg:p53(-/-) leukemia cells exhibit higher survival capacity and are more drug resistant than the leukemia cells from TCL1-Tg:p53wt mice
23160471 Our findings reveal a functional interaction between Tcl1 and Hsp70 and identify Tcl1 as a novel Hsp70 client protein
22875623 TCL1A and ATM are co-expressed in chronic lymphocytic leukemia cells without deletion of 11q.
22674796 Intracellular expression of the TCL1 as well as membrane and intracellular expression of ILT7 in plasmacytoid dendritic cell leukemia (pDCL) samples and 61 non-pDC acute leukemia samples, were tested.
22645177 TCL1 is hyperexpressed in multiple B-cell lymphomas.
22553924 Data indicate that up-regulated transcription of TCL1A was observed in two cases.
22460735 These findings demonstrate that the microenvironment has a proactive role in the regulation of the known signaling enhancer and pro-survival molecule TCL1 in CLL.
22448662 100% of dysgerminomas were positive for TCL1, but all immature teratomas were negative.
22405131 SNPs near the 3' terminus of TCL1A were associated with aromatase inhibitors-dependent musculoskeletal pain. Estradiol induced SNP-dependent TCL1A expression.
22308499 CLL samples with high Tcl1 expression showed a decrease in DNA methylation compared with CLL samples with low Tcl1 expression
22189846 genetic association studies in a Japanese population: Data suggest that a substantial number of patients with T-cell prolymphocytic leukemia exhibit abnormal expression of TCL1A probably due to rearrangement in region of TCL1 gene.
22001392 Using primary chronic lymphocytic leukemia cells we have shown an inverse relationship between TCL1 and PTPROt expression.
21172079 This study identified 4 single nucleotide polymorphisms related to TCL1A that, when present, were associated with musculoskeletal adverse effects to anastrozole or exemestane treatment in postmenopausal women with stage I to III breast cancer.
21130495 Data indicate an inverse correlation between miR-16-1, miR-181a, miR-181b, and level of expression of TCL-1 and BCL-2, which suggest that these miRNAs may implicate in negatively regulating target mRNA at transcriptional level.
20876420 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20553335 TCL1 is a diagnostic marker for intratubular germ cell neoplasia and classic seminoma.
20395523 Immunohistochemical evaluation of TCL1 expression may be useful for substantiating a diagnosis of unclassified type of intratubular germ cell neoplasia or seminoma.
20382409 TCL1 positivity was predominantly found in germinal center phenotype diffuse large B-cell lymphoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20357824 CD5+CD23+ leukemic cell populations in TCL1 transgenic mice show significantly increased proliferation and Akt phosphorylation.
19889012 TCL1 mRNA expression may predict clinical outcome in CLL and that the IGHV3-21 subset, regardless of mutational status, displays high TCL1 expression.
19776126 The authors confirmed that EBNA3C upregulates TCL1 and discovered that EBNA3C upregulates TCL1 through RBP-Jkappa, indicating a central role for EBNA3C interaction with RBP-Jkappa in mediating cell gene transcription.
19668332 establish that the association between TCL1A and IkappaB is compatible with AKT binding to TCL1A, but incompatible with IkappaB binding to NF-kappaB
19536169 MIR34B/MIR34C regulates TCL1 expression in chronic lymphocytic leukemia
19480937 Recurrent loss, but lack of mutations, of the SMARCB1 tumor suppressor gene in T-cell prolymphocytic leukemia with TCL1A-TCRAD juxtaposition.
19155496 Tcl1A unique set of molecules, Tcl1 and galectin-1, defines distinct B cell receptor signaling cascades, dictating survival and death of human naive and immunoglobulin M-positive (IgM+) memory B cells.
19064921 The results indicate that Tcl1 overexpression causes B cell chronic lymphocytic leukemia by directly enhancing NF-kappaB activity and inhibiting AP-1.
18820675 TCL1A expression delineates biological and clinical variability in B-cell lymphoma.
18546844 mediates intracellular signals to regulate a variety of cellular responses and its genomic mutations and alterations underlie cancer, viral and/or bacterial infections.[review]
17890451 in T-cell prolymphocytic leukemia, TCL1 represents a highly regulated, targetable modulator of T cell receptor-mediated AKT growth signaling
17846228 TCL1 inhibits activation-induced cell death in T cells by blocking PKCtheta and ERK activation, upon cellular activation
17659340 Lower TCL-1 levels were associated with improved complete remission rate and progression-free survival
17625607 TCL1A deregulation may be caused by faulty gene silencing as a potential consequence of losses of 7q miRNAs in splenic marginal zone lymphoma.
17592280 TCL1 expression in B-cell tumors parallels its regulation in non-neoplastic B cells and can be used diagnostically as an indicator of the differentiation stage of a given B-cell tumor.
17548807 TORC2 regulates germinal center repression of the TCL1 oncoprotein to promote B cell development and inhibit transformation.
17360849 Biological action of the proto-oncogene TCL1 family and the development avenues for a suppressive drug specific for Akt, a core intracellular survival regulator.[REVIEW]
17178851 Expression levels of microRNA generally inversely correlated with Tcl1 expression in chronic lymphocytic leukemia.
17151114 In EBV-negative diffuse large B-cell lymphoma and Burkitt lymphoma-derived cell lines infected in vitro with a recombinant EBV, high expression of EBNA2 inversely correlated with expression of germinal center-associated genes, BCL6 and TCL1.
16002684 Detailed mechanism for TCL1-augmented signaling helps explain the delayed occurrence of mature T cell expansions and leukemias despite tumorigenic TCL1 dysregulation that begins in early thymocytes.
15459205 Akt kinase activity can be inhibited by a peptide spanning the betaA strand of the proto-oncogene TCL1
15325703 Involved in the pathogenesis of mature leukemias and lymphomas: mature T-cell leukemia and chronic lymphocytic leukemia(review)
12672960 altered expression in Burkitt lymphomas in the presence of Epstein-Barr virus
12576313 results further support derivation of blastic tumors of skin from dendritic cells and demonstrate TCL1 proto-oncogene protein expression in this tumor
12421830 oncogene transactivation by Sp1
12381789 data demonstrate that TCL1 is a powerful oncogene that, when overexpressed in both B and T cells, predominantly yields mature B cell lymphomas
12127395 Increased TCL1 expression correlates with PBC-ALL progression and loss of TEL expression. TCL1 expression is important for the maturation of precursor lymphocytes but not differentiated B or T cells.
12009899 An exposed hydrophobic patch composed of two discontinuous amino acid stretches has been identified near one end of the TCL1 beta-barrel that is required for TCL1-AKT binding association.

AA Sequence

MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPS      1 - 70
LLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD                               71 - 114
//

Text Mined References (76)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26493619 2016 TCL1 expression patterns in Waldenström macroglobulinemia.
26299617 2015 Whole-transcriptome analysis of flow-sorted cervical cancer samples reveals that B cell expressed TCL1A is correlated with improved survival.
26090867 2015 miR-181b as a therapeutic agent for chronic lymphocytic leukemia in the Eµ-TCL1 mouse model.
25936528 2015 The regulatory interaction of EVI1 with the TCL1A oncogene impacts cell survival and clinical outcome in CLL.
25688912 2015 TCL1 expression predicts overall survival in patients with mantle cell lymphoma.
25646413 2015 TCL1 targeting miR-3676 is codeleted with tumor protein p53 in chronic lymphocytic leukemia.
25481307 2015 Polymorphic genetic variations of cytochrome P450 19A1 and T-cell leukemia 1A genes in the Tamil population.
25416956 2014 A proteome-scale map of the human interactome network.
25348018 2014 AKT-pathway inhibition in chronic lymphocytic leukemia reveals response relationships defined by TCL1.
25310835 2014 T-cell prolymphocytic leukemia frequently shows cutaneous involvement and is associated with gains of MYC, loss of ATM, and TCL1A rearrangement.
24966976 2014 T-cell lymphoblastic leukemia/lymphoma with t(7;14)(p15;q32) [TCR?-TCL1A translocation]: a case report and a review of the literature.
23608884 2014 Loss of p53 and altered miR15-a/16-1?MCL-1 pathway in CLL: insights from TCL1-Tg:p53(-/-) mouse model and primary human leukemia cells.
23160471 2013 Heat shock protein 70 regulates Tcl1 expression in leukemia and lymphomas.
22875623 2013 TCL1A and ATM are co-expressed in chronic lymphocytic leukemia cells without deletion of 11q.
22674796 2012 Intracytoplasmic detection of TCL1--but not ILT7-by flow cytometry is useful for blastic plasmacytoid dendritic cell leukemia diagnosis.
22645177 2012 TCL1: a shared tumor-associated antigen for immunotherapy against B-cell lymphomas.
22553924 2012 Recurrent breakpoints in 14q32.13/TCL1A region in mature B-cell neoplasms with villous lymphocytes.
22460735 2012 Stromal cells modulate TCL1 expression, interacting AP-1 components and TCL1-targeting micro-RNAs in chronic lymphocytic leukemia.
22448662 2012 Diagnostic utility of CD117, CD133, SALL4, OCT4, TCL1 and glypican-3 in malignant germ cell tumors of the ovary.
22405131 2012 Aromatase inhibitors, estrogens and musculoskeletal pain: estrogen-dependent T-cell leukemia 1A (TCL1A) gene-mediated regulation of cytokine expression.
22308499 2012 Tcl1 protein functions as an inhibitor of de novo DNA methylation in B-cell chronic lymphocytic leukemia (CLL).
22189846 2012 TCL1A gene involvement in T-cell prolymphocytic leukemia in Japanese patients.
22001392 2011 AP-1 elements and TCL1 protein regulate expression of the gene encoding protein tyrosine phosphatase PTPROt in leukemia.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21172079 2010 Genome-wide case-control study of musculoskeletal adverse events and functional genomics in women receiving aromatase inhibitors: going beyond associations.
21130495 2011 Aberrant microRNA expression in Chinese patients with chronic lymphocytic leukemia.
20876420 2010 Genome-wide associations and functional genomic studies of musculoskeletal adverse events in women receiving aromatase inhibitors.
20553335 2010 TCL1 is a diagnostic marker for intratubular germ cell neoplasia and classic seminoma.
20395523 2010 TCL1 protein expression in testicular germ cell tumors.
20382409 2010 T-cell leukemia 1 expression in nodal Epstein-Barr virus-negative diffuse large B-cell lymphoma and primary mediastinal B-cell lymphoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20357824 2010 CD5+CD23+ leukemic cell populations in TCL1 transgenic mice show significantly increased proliferation and Akt phosphorylation.
19889012 2010 IGHV3-21 gene usage is associated with high TCL1 expression in chronic lymphocytic leukemia.
19776126 2009 Epstein-Barr virus nuclear protein 3C domains necessary for lymphoblastoid cell growth: interaction with RBP-Jkappa regulates TCL1.
19668332 2009 The TCL1A oncoprotein interacts directly with the NF-kappaB inhibitor IkappaB.
19536169 2009 miR-34b/miR-34c: a regulator of TCL1 expression in 11q- chronic lymphocytic leukaemia?
19480937 2009 Recurrent loss, but lack of mutations, of the SMARCB1 tumor suppressor gene in T-cell prolymphocytic leukemia with TCL1A-TCRAD juxtaposition.
19155496 2009 T cell leukemia/lymphoma 1 and galectin-1 regulate survival/cell death pathways in human naive and IgM+ memory B cells through altering balances in Bcl-2 family proteins.
19064921 2008 Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL.
18820675 2009 TCL1A expression delineates biological and clinical variability in B-cell lymphoma.
18546844 2008 [PI3K-AKT network roles in infectious diseases].
17890451 2008 High TCL1 expression and intact T-cell receptor signaling define a hyperproliferative subset of T-cell prolymphocytic leukemia.
17846228 2007 The TCL1 oncoprotein inhibits activation-induced cell death by impairing PKCtheta and ERK pathways.
17659340 2007 Expression of TCL-1 as a potential prognostic factor for treatment outcome in B-cell chronic lymphocytic leukemia.
17625607 2007 MicroRNA losses in the frequently deleted region of 7q in SMZL.
17592280 2007 TCL1 in B-cell tumors retains its normal b-cell pattern of regulation and is a marker of differentiation stage.
17548807 2007 TORC2 regulates germinal center repression of the TCL1 oncoprotein to promote B cell development and inhibit transformation.
17360849 2007 Proto-oncogene TCL1: more than just a coactivator for Akt.
17178851 2006 Tcl1 expression in chronic lymphocytic leukemia is regulated by miR-29 and miR-181.
17151114 2007 EBNA2 interferes with the germinal center phenotype by downregulating BCL6 and TCL1 in non-Hodgkin's lymphoma cells.
16934922 2007 The TCL1 oncoprotein binds the RNase PH domains of the PNPase exoribonuclease without affecting its RNA degrading activity.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16002684 2005 T cell leukemia-1 modulates TCR signal strength and IFN-gamma levels through phosphatidylinositol 3-kinase and protein kinase C pathway activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459205 2004 Inhibition of Akt kinase activity by a peptide spanning the betaA strand of the proto-oncogene TCL1.
15325703 2004 Tcl1 as a model for lymphomagenesis.
12672960 2003 T cell leukemia I oncogene expression depends on the presence of Epstein-Barr virus in the virus-carrying Burkitt lymphoma lines.
12576313 2003 TCL1 expression in plasmacytoid dendritic cells (DC2s) and the related CD4+ CD56+ blastic tumors of skin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421830 2003 Sp1 transactivation of the TCL1 oncogene.
12381789 2002 Dysregulated TCL1 promotes multiple classes of mature B cell lymphoma.
12127395 2002 Differential expression of TCL1 during pre-B-cell acute lymphoblastic leukemia progression.
12009899 2002 A modeled hydrophobic domain on the TCL1 oncoprotein mediates association with AKT at the cytoplasmic membrane.
11839817 2002 Identification of Akt association and oligomerization domains of the Akt kinase coactivator TCL1.
11707444 2002 Differential regulation of Akt kinase isoforms by the members of the TCL1 oncogene family.
11607815 2001 The role of TCL1 in human T-cell leukemia.
10983986 2000 The protooncogene TCL1 is an Akt kinase coactivator.
10716693 2000 Tcl1 enhances Akt kinase activity and mediates its nuclear translocation.
10077617 1999 Abnormalities at 14q32.1 in T cell malignancies involve two oncogenes.
9738977 1998 Expression of the TCL1 gene at 14q32 in B-cell malignancies but not in adult T-cell leukemia.
9520462 1998 Deregulated expression of TCL1 causes T cell leukemia in mice.
9519406 1998 Crystal structure of p14TCL1, an oncogene product involved in T-cell prolymphocytic leukemia, reveals a novel beta-barrel topology.
7987816 1994 Characterization and localization of the TCL-1 oncogene product.
7809072 1994 Identification of the TCL1 gene involved in T-cell malignancies.
2783489 1989 Molecular analysis of a t(14;14) translocation in leukemic T-cells of an ataxia telangiectasia patient.