Property Summary

NCBI Gene PubMed Count 21
PubMed Score 126.66
PubTator Score 13.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 5.7e-04
ovarian cancer 8491 4.1e-03
Disease Target Count Z-score Confidence
Cancer 2346 4.147 2.1
Disease Target Count Z-score Confidence
Primary progressive multiple sclerosis 3 3.661 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.083 5.7e-04
ovarian cancer 1.100 4.1e-03

Gene RIF (6)

PMID Text
26880200 Ndel1 acts as a novel upstream regulator of the trichoplein-Aurora A pathway to inhibit primary cilia assembly.
24403067 These findings underscore the complexity of PGC-1alpha-mediated mitochondrial homeostasis and establish mitostatin as a key regulator of tumor cell mitophagy and angiostasis.
21325031 Trichoplein controls microtubule anchoring at the centrosome by binding to Odf2 and ninein.
20930847 Trichoplein/mitostatin is a new regulator of mitochondria-endoplasmic reticulum juxtaposition.
18931701 MITOSTATIN was found within a 3.2-kb transcript for an approximately 62 kDa mitochondrial protein with tumor suppressor activity. It inhibits cell growth, is proapoptotic and downregulates Hsp27.
15731013 trichoplein is a keratin 8/18-binding protein that may be involved in the organization of the apical network of keratin filaments and desmosomes in simple epithelial cells

AA Sequence

MALPTLPSYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSYQRSMHAYQRE      1 - 70
KMKEEKRRSLEARREKLRQLMQEEQDLLARELEELRLSMNLQERRIREQHGKLKSAKEEQRKLIAEQLLY     71 - 140
EHWKKNNPKLREMELDLHQKHVVNSWEMQKEEKKQQEATAEQENKRYENEYERARREALERMKAEEERRQ    141 - 210
LEDKLQAEALLQQMEELKLKEVEATKLKKEQENLLKQRWELERLEEERKQMEAFRQKAELGRFLRHQYNA    211 - 280
QLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQLQLERAREAELQMLL    281 - 350
REEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLEEVRELAR    351 - 420
REKEESEKLKSARKQELEAQVAERRLQAWEADQQEEEEEEEARRVEQLSDALLQQEAETMAEQGYRPKPY    421 - 490
GHPKIAWN                                                                  491 - 498
//

Text Mined References (22)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26880200 2016 Ndel1 suppresses ciliogenesis in proliferating cells by regulating the trichoplein-Aurora A pathway.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25416956 2014 A proteome-scale map of the human interactome network.
25270598 2014 Ubiquitin-proteasome system controls ciliogenesis at the initial step of axoneme extension.
24403067 2014 Decorin induces mitophagy in breast carcinoma cells via peroxisome proliferator-activated receptor ? coactivator-1? (PGC-1?) and mitostatin.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21325031 2011 Trichoplein controls microtubule anchoring at the centrosome by binding to Odf2 and ninein.
20930847 2010 Trichoplein/mitostatin regulates endoplasmic reticulum-mitochondria juxtaposition.
18931701 2009 MITOSTATIN, a putative tumor suppressor on chromosome 12q24.1, is downregulated in human bladder and breast cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15731018 2005 Small urine leak after renal transplantation: detection by delayed 99mTc-DTPA renography--a case report.
15731017 2005 Outpatient therapeutic 131I for thyroid cancer.
15731016 2005 Fundamentals of ICANL accreditation.
15731015 2005 X-ray imaging physics for nuclear medicine technologists. Part 2: X-ray interactions and image formation.
15731014 2005 Band 3 modifications in Plasmodium falciparum-infected AA and CC erythrocytes assayed by autocorrelation analysis using quantum dots.
15731013 2005 Identification of trichoplein, a novel keratin filament-binding protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.