Property Summary

NCBI Gene PubMed Count 68
PubMed Score 39.63
PubTator Score 86.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma -1.194 1.5e-03
esophageal adenocarcinoma 1.300 1.8e-02
pancreatic ductal adenocarcinoma liver m... 1.470 4.2e-03
sarcoidosis -1.100 1.1e-04
non-inflammatory breast cancer -1.200 6.3e-04

Protein-protein Interaction (1)

Gene RIF (40)

PMID Text
26642437 Tcf7 levels are lower in islets taken from patients with type 2 diabetes. Knockdown of TCF7 in islets impairs the cytoprotective responsiveness to GIP and enhances the magnitude of apoptotic injury.
26289446 TCF7 plays critical roles in lung diseases [review]
26079538 Findings indicate that breast cancer cells with a hyperactive AF1q/TCF7/CD44 regulatory axis in the primary sites may represent "metastatic founder cells" which have invasive properties.
25869100 Capsaicin-induced apoptosis in pancreatic cancer cells was associated with inhibition of beta-catenin signaling due to the dissociation of beta-catenin/TCF-1 complex and the process was orchestrated by STAT-3.
25842979 induction of expression activates the Wnt signaling pathway, leading to priming of liver cancer stem cells self-renewal and tumor propagation
25738174 RUNX2 signaling pathways with their partners TCF7 and FGFR1/2 may not be involved in CCD pathogenesis
25436980 we show that TCF7 is a direct target of miR-34a in prostate cancer that has metastasized to the bone
25143352 Results suggest ivermectin as therapeutic WNT protein-TCF transcription factor pathway response blocker to treat WNT-TCF-dependent diseases including multiple cancers.
24551047 miRNAs inhibited the expression of the luciferase reporter constructs containing 3'UTRs of these genes and downregulated protein expression of TERT and the TCF7 transcription factor, which mediates the canonical Wnt pathway.
23966864 we establish that ATF2 family members physically and functionally interact with TCF1/LEF1 factors to promote target gene expression and hematopoietic tumor cell growth
23572277 Studied the expression of TCF/LEF and SFRP family members (SFRP1 and SFRP3) to gain a better understanding of biological signaling pathways responsible for epidemiology and clinical parameters of clear cell RCC (cRCC).
22778133 findings show that induction of a dominant negative C-clamp version of TCF1 (dnTCF1E) induces p21 expression and a stall in the growth of DLD1 colon cancer cells; results indicate that a rapid-response WNT/p21 circuit is driven by C-clamp target gene selection
22550000 The repression of syndecan-2 by Wnt/beta-catenin/TCF signaling contributes to the resistance of osteosarcoma cells to doxorubicin.
22535304 in this review, we will focus on the function of beta-catenin/TCF-1 pathway in the regulation of thymic and peripheral T cell differentiation processes--{REVIEW}
22111711 In this review we present mounting evidence for the interdependency of TCF7/LEF1 variant expression and functions with cell lineage and cell state. [Review]
21881822 Results suggest that Tcf-1 may contribute to pathogenesis of acquired aplastic anemia by regulating downstream gene expression such as c-myc and CD44.
21447180 Findings demonstrate that t-DARPP regulates beta-catenin/TCF activity, thereby implicating a novel oncogenic signaling in upper gastrointestinal cancers.
21339363 Transgenic T cell factor 1 (TCF1) binds to regulatory regions of the IL17 gene and directly regulates IL17A and IL17F gene expression.
21285352 Data show that upon HIPK2-mediated phosphorylation, TCF3 is replaced with positively acting TCF1 at a target promoter.
20844743 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20613673 Observational study of gene-disease association. (HuGE Navigator)
20603037 Observational study of gene-disease association. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19956102 TCF7 is involved in genetic risk to Type I Diabetes, although the associations observed for both the intronic SNP rs17653687 and the nonsynonymous change encoded by rs5742913 are relatively modes.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19559392 Observational study of gene-disease association. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19028820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18974840 Observational study of gene-disease association. (HuGE Navigator)
16424171 Involvement of transcription factor 7 (T cell factor-1) in the wingless type protein (WNT) signaling pathway not only regulates T cell development, but also peripheral T cell differentiation.
15778344 Ly-49A effectively limits Ag-driven T cell proliferation, cytokine production, and changes in surface receptor expression, and effectively limits Ag-specific CD4 cell responses even in the presence of sustained autoantigen expression in vivo
14960582 TCF1 is phosphorylated and inhibited by Wnt signal transduction through the Tak1 pathway
12847244 Enforced expression of TCF-1 in transgenic mice yields an expanded Ly-49A subset of natural killer (NK) cells; TCF-1 regulates stable induction of Ly-49A gene expression by formation of a nucleoprotein complex at the Ly-49A promoter.
12765974 A polymorphism in ths gene, C883A, is associated with type 1 diabetes.
12408869 beta-catenin and TCF inversely control the expression of the EphB2/EphB3 receptors and their ligand ephrin-B1 in colorectal cancer and along the crypt-villus axis.

AA Sequence

MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPG      1 - 70
VPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQH     71 - 140
PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTV    141 - 210
SWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYM    211 - 280
KEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSR    281 - 350
EKHQESTTETNWPRELKDGNGQESLSMSSSSSPA                                        351 - 384
//

Text Mined References (69)

PMID Year Title
27447672 2016 TCF/LEF Transcription Factors: An Update from the Internet Resources.
26642437 2016 TCF1 links GIPR signaling to the control of beta cell function and survival.
26379372 2015 Transcriptional Regulatory Network for the Development of Innate Lymphoid Cells.
26289446 2015 Roles of transcriptional factor 7 in production of inflammatory factors for lung diseases.
26079538 2015 AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis.
25869100 2015 Inhibition of ?-catenin signaling suppresses pancreatic tumor growth by disrupting nuclear ?-catenin/TCF-1 complex: critical role of STAT-3.
25842979 2015 The long noncoding RNA lncTCF7 promotes self-renewal of human liver cancer stem cells through activation of Wnt signaling.
25738174 2015 Expression of RUNX2 and its signaling partners TCF7, FGFR1/2 in cleidocranial dysplasia.
25678599 2015 The Tumor-Suppressor WWOX and HDAC3 Inhibit the Transcriptional Activity of the ?-Catenin Coactivator BCL9-2 in Breast Cancer Cells.
25665079 2015 Transcriptional regulation of innate and adaptive lymphocyte lineages.
25436980 2015 MicroRNA-34a regulates WNT/TCF7 signaling and inhibits bone metastasis in Ras-activated prostate cancer.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25143352 2014 The river blindness drug Ivermectin and related macrocyclic lactones inhibit WNT-TCF pathway responses in human cancer.
24551047 2014 Multiple tumor suppressor microRNAs regulate telomerase and TCF7, an important transcriptional regulator of the Wnt pathway.
23966864 2013 ?-Catenin-independent activation of TCF1/LEF1 in human hematopoietic tumor cells through interaction with ATF2 transcription factors.
23572277 2013 Expression of secreted frizzled-related protein 1 and 3, T-cell factor 1 and lymphoid enhancer factor 1 in clear cell renal cell carcinoma.
22778133 2012 A WNT/p21 circuit directed by the C-clamp, a sequence-specific DNA binding domain in TCFs.
22550000 2012 Targeted inhibition of T-cell factor activity promotes syndecan-2 expression and sensitization to doxorubicin in osteosarcoma cells and bone tumors in mice.
22535304 2012 ?-catenin/TCF-1 pathway in T cell development and differentiation.
22111711 2011 Cell-context dependent TCF/LEF expression and function: alternative tales of repression, de-repression and activation potentials.
21881822 2012 Tcf-1 gene silence suppresses downstream gene expression in CD4(+) T cells from bone marrow of aplastic anemia patients.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21814277 2011 A critical role for TCF-1 in T-lineage specification and differentiation.
21447180 2011 Regulation of ?-catenin by t-DARPP in upper gastrointestinal cancer cells.
21339363 2011 T cell factor-1 negatively regulates expression of IL-17 family of cytokines and protects mice from experimental autoimmune encephalomyelitis.
21285352 2011 Phosphorylation of TCF proteins by homeodomain-interacting protein kinase 2.
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20727791 2010 Differentiation and persistence of memory CD8(+) T cells depend on T cell factor 1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20613673 Association between polymorphisms in Wnt signaling pathway genes and bone mineral density in postmenopausal Korean women.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20128911 2010 SLUG: a new target of lymphoid enhancer factor-1 in human osteoblasts.
20026746 2010 Constitutive activation of Wnt signaling favors generation of memory CD8 T cells.
19956102 2009 Evidence for association of the TCF7 locus with type I diabetes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19358846 2009 The RNA aptamer disrupts protein-protein interaction between beta-catenin and nuclear factor-kappaB p50 and regulates the expression of C-reactive protein.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19028820 2009 Polymorphisms in inflammatory genes and the risk of ischemic stroke and transient ischemic attack: results of a multilocus genotyping assay.
18974840 2008 Identification of novel single nucleotide polymorphisms in inflammatory genes as risk factors associated with trachomatous trichiasis.
18772112 2008 RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis.
18579517 2008 LEF-1 negatively controls interleukin-4 expression through a proximal promoter regulatory element.
17510365 2007 Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.
16442529 2006 Bcr interferes with beta-catenin-Tcf1 interaction.
16424171 2006 Human naive CD8 T cells down-regulate expression of the WNT pathway transcription factors lymphoid enhancer binding factor 1 and transcription factor 7 (T cell factor-1) following antigen encounter in vitro and in vivo.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15778344 2005 Transgenic Ly-49A inhibits antigen-driven T cell activation and delays diabetes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14960582 2004 Wnt activates the Tak1/Nemo-like kinase pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12847244 2003 Initiation and limitation of Ly-49A NK cell receptor acquisition by T cell factor-1.
12765974 2003 A polymorphism in the TCF7 gene, C883A, is associated with type 1 diabetes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408869 2002 Beta-catenin and TCF mediate cell positioning in the intestinal epithelium by controlling the expression of EphB/ephrinB.
11266540 2001 All Tcf HMG box transcription factors interact with Groucho-related co-repressors.
10489374 1999 Synergy between tumor suppressor APC and the beta-catenin-Tcf4 target Tcf1.
9783587 1998 The Xenopus Wnt effector XTcf-3 interacts with Groucho-related transcriptional repressors.
9488439 1998 Two members of the Tcf family implicated in Wnt/beta-catenin signaling during embryogenesis in the mouse.
8622675 1996 Extensive alternative splicing and dual promoter usage generate Tcf-1 protein isoforms with differential transcription control properties.
7640309 1995 The human high mobility group (HMG)-box transcription factor TCF-1: novel isoforms due to alternative splicing and usage of a new exon IXA.
7579399 1995 The human TCF-1 gene encodes a nuclear DNA-binding protein uniquely expressed in normal and neoplastic T-lineage lymphocytes.
1989880 1991 Identification and cloning of TCF-1, a T lymphocyte-specific transcription factor containing a sequence-specific HMG box.
1569101 1992 The human T cell transcription factor-1 gene. Structure, localization, and promoter characterization.