Property Summary

NCBI Gene PubMed Count 178
PubMed Score 577.87
PubTator Score 355.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 1.100 3.8e-06
astrocytoma 1.600 1.2e-24
oligodendroglioma 1.700 1.1e-02
psoriasis -1.700 1.8e-04
glioblastoma 2.100 3.0e-06
osteosarcoma -3.014 8.7e-07
posterior fossa group A ependymoma 1.400 8.5e-07
sonic hedgehog group medulloblastoma 2.800 4.9e-11
atypical teratoid / rhabdoid tumor 2.100 1.4e-06
medulloblastoma, large-cell 3.000 2.0e-06
primitive neuroectodermal tumor 1.700 8.8e-06
tuberculosis 1.100 6.0e-06
pancreatic ductal adenocarcinoma liver m... 1.146 3.7e-02
non-small cell lung cancer 1.166 2.5e-26
intraductal papillary-mucinous carcinoma... 1.200 1.2e-02
lung cancer 2.400 3.7e-05
colon cancer 1.200 4.5e-06
pediatric high grade glioma 1.600 5.6e-06
subependymal giant cell astrocytoma 1.288 1.7e-02
lung adenocarcinoma 1.200 2.0e-09
ductal carcinoma in situ 1.100 9.7e-05
ovarian cancer 2.100 1.2e-04

Protein-protein Interaction (1)

Gene RIF (87)

PMID Text
26942192 Our data suggest that E2A antagonism of PU.1 activity contributes to its ability to commit multipotential hematopoietic progenitors to the lymphoid lineages.
26237075 We observed significant enrichment of the neuroactive ligand-receptor interaction pathway in TCF3-PBX1 as well as an enrichment of genes involved in immunity and infection pathways in ETV6-RUNX1 subtype
26223652 Data show that microRNAs miR-155 and miR-16 downregulate activation-induced cytidine deaminase (AID) and transcription factor E47 in B Cells through binding of the 3'-untranslated regions.
26214592 Drug response profiling of matched patient-derived xenografts revealed a distinct profile for TCF3-HLF ALL with resistance to conventional chemotherapeutics but sensitivity to glucocorticoids.
26212009 E47 is a novel substrate of PAK5, and PAK5-mediated phosphorylation of E47 promotes epithelial-mesenchymal transition. High expression of phospho-E47 was associated with an aggressive phenotype of colon cancer and metastasis.
25894862 Over expression of E47 reprograms human pancreatic cancer cells to a quiescent acinar state with reduced tumorigenic potential.
25778840 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25659031 These results indicate that a dynamic interplay of TCF transcription factors governs MYC gene expression in colorectal cancers.
25615280 our data suggest a collaborative action between autophagy and ubiquitination in the degradation of E2A/Pbx1, thereby revealing a novel strategy for targeted preventive or treatment therapy on the pediatric ALL.
25551271 When intensive chemotherapy was used, the TCF3-PBX1 was associated with a favorable outcome in childhood pre-B ALL.
25499232 results suggest that E47 has diverse effects in T-ALL but that functional deficiency of E47 is not a universal feature of Lmo2-induced T-ALL.
25375219 Results show the up-regulation of TCF3, which is mainly caused by promoter hypomethylation, is one of the molecular mechanisms involved in the development and progression of colorectal cancer.
25116187 TCF3 rearrangement [t(1;19) (q23;p13)] was detected in 16 (20%) out of the 80 studied patients, and it was significantly associated with splenomegaly, lymphadenopathy, CNS infiltration.
24920014 TCF3 is a novel susceptibility locus for Hodgkin lymphoma.
24596249 TCF/TLE tetramer complex promotes structural transitions of chromatin to mediate repression.
24578304 In this study, we showed that TCF3-PBX1 positive pediatric BCP-ALL patients treated according to the JACLS ALL02 and CCLSG ALL2004 protocol had favorable outcomes
24454819 E2A is an independent prognostic factor for colorectal cancer patients and targets miR-320a to regulate cell proliferation of colon cancer cells.
24369055 results suggest that E2A suppresses CRC cell metastasis, at least partially if not all, by inhibiting YAP expression
24216514 4 patients with agammaglobulinemia had the same de novo mutation in the broadly expressed transcription factor E47. The mutant protein (E555K) was stable in patient-derived EBV-transformed cell lines and cell lines transfected with expression vectors.
23940558 Targeted re-sequencing identified rs3106189 at the 5' UTR of TAPBP and rs1052918 at the 3' UTR of TCF3 to be associated with the overall survival of colorectal cancer patients.
23851690 NF-kappaB potentiated the binding of E2A to an E-box motif located immediately downstream of the 2 closely-spaced transcription start sites for sustained 14-3-3gamma expression and CSR induction.
23812588 Within the AETFC complex, AML1-ETO oligomerization is required for a specific interaction between the oligomerized NHR2 domain and a novel NHR2-binding (N2B) motif in E proteins, including HEB and E2A. Disruption of this interaction by point mutations abrogates AML1-ETO-induced hematopoietic stem/progenitor cell self-renewal and leukemogenesis.
23812588 In t(8;21) leukemia cells, the two E proteins, HEB and E2A, function as components of the stable AML1-ETO-containing transcription factor complex (AETFC). The AETFC components cooperatively regulate gene expression and contribute to leukemogenesis.
23688269 E2A-PBX1 fusion gene caused by t(1;19)(q23;p13) may be a common genetic change in AIS and a survival determinant for female AIS patients at early stage.
23555842 E47 interacts with Id1 in E47 overexpressing MDCK cells that underwent a full epithelial-mesenchymal transition as well as in mesenchymal breast carcinoma and melanoma cell lines
23492770 TCF3, a novel positive regulator of osteogenesis, plays a crucial role in miR-17 modulating the diverse effect of canonical Wnt signaling in different microenvironments.
23135478 High expression of TCF3 is associated with neuroblastoma progression.
23090119 Our results identify TCF3 as a central regulator of tumor growth and initiation.
23085504 The molecular mechanism for this effect of EB1089 on the aromatase gene expression was found to be mediated by the vitamin D receptor (VDR), vitamin D receptor interacting repressor (VDIR) and Williams syndrome transcription factor (WSTF).
23063976 Tcf3is partially responsible for the butyrate-resistant phenotype of colorectal cancer cells, as this DNA-binding protein suppresses the hyperinduction of Wnt activity by butyrate.
22972921 Absence of T cell precursor potential, both in vivo and in vitro, is due to low Notch1 expression and secondary to inhibition of E2A protein activity by members of the inhibitor of DNA binding (Id) protein family.
22829926 Protein inhibitor of activated STAT, PIASy regulates alpha-smooth muscle actin expression by interacting with E12 in mesangial cells.
22743623 E2A-HLF sensitizes t(17;19)-positive acute lymphoblastic leukemia to graft-versus-leukemia effect by upregulating death receptors for TRAIL.
22564737 These results for the first time demonstrate that E2A could in fact acts as a tumor promoter at least in prostate cancer.
22544934 Transcription factor E2A plays critical roles in inducing immunoglobulin (Ig)kappa rearrangement by directly binding to and increasing chromatin accessibility at target gene segments.
22514271 These results thus implicate the E2A-CDKN1A transcriptional axis in the control of megakaryopoiesis and reveal the lineage-selective inhibition of this axis as a likely mechanistic basis for the inhibitory effects of cAMP signaling.
22387215 We present the first evidence that the portion of E2A proteins found within the oncogenic fusion protein E2A-PBX1 and including the transcriptional activation domains can enhance the HAT activity of CBP/p300
22354994 studies show that the entire ensemble of Id proteins has the ability to interact with E47, identify factors that associate with E47, and reveal a spectrum of phosphorylated residues in E47, including an AKT substrate site
22207202 our findings show that the E2A proteins are acetylated at specific residues as a consequence of lysine acetyltranferases(CBP, p300 and PCAF ) recruitment
21828274 HEB and E2A-bind the SCA motif at regions overlapping SMAD2/3 and FOXH1
21788410 E2A exhibits a tumor suppressor function in human lymphoid cells.
21655267 The results indicate that in cancer cells E2A, FOXO1 and FOXP1 regulate RAG1 and RAG2 expression, which initiates Ig gene rearrangement much in the way similar to B lymphocytes.
21551245 The E2A, a key transcription factor associated with the B-cell activation profile, regulates apoptosis in CLL and may contribute to disease pathology.
21498546 altering the balance between Id3 and E47 is both necessary and sufficient to regulate the cell cycle in PDA cell
21285352 HIPK2 up-regulates transcription by phosphorylating TCF3, a transcriptional repressor, but inhibits transcription by phosphorylating LEF1, a transcriptional activator.
21258409 Data show that miR-495 expression was directly modulated by transcription factor E12/E47, and promotes oncogenesis via downregulation of E-cadherin and REDD1.
21212793 CD38 upregulation was primarily conditioned by the presence of E2A and then by the G allele
20802470 Aberrant E2A expression is a diagnostic feature of a subtype of gastric MALT lymphoma with weaker plasmacytoid infiltrates and stronger miR-223 expression.
20519628 E2A-HLF promotes cell survival of t(17;19)- acute lymphoblastic leukemia cells by aberrantly up-regulating LMO2 expression
20217071 Suppressed TCF3 gene expression is associated with cigarette smoking.
20050020 TCF3 is preferentially expressed by human bulge cells, compared to differentiated hair follicle keratinocytes
20022378 Ca(2+) down-regulates SLC and CD19 gene expression upon pre-BCR activation through inhibition of E2A by Ca(2+)/calmodulin.
19801649 Mixed lineage kinase phosphorylates transcription factor E47 and inhibits TrkB expression to link neuronal death and survival pathways
19299559 multiple inhibitory mechanisms can be suppressed and myogenic differentiation can be induced in the RD rhabdomyosarcomas by increasing the abundance of MyoD:E-protein heterodimers
19125693 hCASK regulation of cell growth might involve p21 expression, and that the bHLH (basic helix-loop-helix) transcription factor E2A probably participates in hCASK regulation of p21 expression
18727914 E2A and Na/K-ATPase beta1 subunit expression in epithelial cells are regulated by interactions between these proteins.
18455790 The prevalence of the E2A-PBX1 fusion gene is one of the highest that has been described thus far in childhood acute lymphoblastic leukemia.
18390709 results obtained with activated CD19(+) B cells show that the expression of transcription factor E2A, activation-induced cytidine deaminase, and Iggamma1 circle transcripts progressively decrease with age
17311319 Involvement of the TCF3 gene in 19p13 rearrangements and in identifying novel and cryptic TCF3 translocations and also acts as a tumor suppressor gene in b-cell precursor acute lymphoblastic leukemia.
17272506 E2A proteins prevent lymphoma cell expansion, at least in part through regulation of Gfi1b and modulation of Gata3 expression.
17183364 In childhood acute lymphoblastic leukemia and hypercalcemia, translocation was observed in E2A-HLF fusion protein.
16814783 role of the E2A gene products in the progression of CsA-induced Epithelial-mesenchymal transition and provide novel insights into CsA-induced renal fibrosis.
16782810 E47 coordinately regulates the expression of genes involved in cell survival, cell cycle progression, lipid metabolism, stress response, and lymphoid maturation.
16769578 Targeted-E2A-PBX1 inhibition leads to reduced expression of the EB-1 and Wnt16b genes; aberrant expression of these genes may be a key step in leukemogenesis in t(1;19)-positive pre-B leukemia.
16705184 Global gene expression analysis in neuroblastoma cells engineered to acutely express the E protein E47 and Id2, showed that p57Kip2 is a target of E47.
16546275 activin A enhances PAX4 expression by enhanced transactivation of E47/E12 proteins and might result in a cumulative transactivation of the promoter
16449526 Notch1 is an important "second hit" for the transformation of E2A deficient T cell lymphomas.
16215946 The patients with immunophenotype of Pre-B-acute lymphoblastic leukemia were found to carry: E2A/PBX1 and E2A/HLF.
16206189 The E2A-HLF-mediated over-expression of ABCB1 may play a role in the clinical phenotype of ALLs with a t(17;19), suggesting pharmacologic modulation of ABCB1 activity as a rational therapeutic strategy for this chemotherapy resistant subtype of ALL.
16055439 the SREBP-1c.BETA2.E47 complex is in a DNA looping structure which is required for efficient recruitment of CREB-binding protein/p300
16007194 E12 and E47 modulate both MyoD and Id1 degradation and may have implications for the physiological regulation of muscle
15555546 A reporter assay with the p21 promoter demonstrated that Snail inhibited expression of p21 induced by E2A.
15509787 FHL2 interacts with Hand1 via the bHLH domain and is able to repress Hand1/E12 heterodimer-induced transcription
15507449 E2A-PBX1 interacts directly with the KIX domain of CBP/p300 in the induction of proliferation in primary hematopoietic cells
15351717 dHAND/E-protein (E2A, ME2, and ALF1) heterodimers have distinct DNA binding specificities
15333839 study identifes E proteins(HEB, E2A) as AML1-ETO targets whose dysregulation may be important for t(8;21) leukemogenesis, as well as an E protein silencing mechanism that is distinct from that associated with differentiation-inhibitory proteins
15310760 E2A is a positive regulator for one set of genes and a negative regulator for another set of genes in developing B lymphocytes
15280352 Ca2+ signaling can inhibit the transcriptional activities of E12 and E47 through direct binding of Ca2+/calmodulin to the basic sequence of E-proteins
15242870 in B cells, E47 and PU.1/IRF-4 interact with the E-box motifs and the EICE, respectively, and act synergistically in the activation of CIITA-PIII
15138269 E47 is involved in the regulation of p16(INK4a) transcription in cellular senescence
15070701 E2A-HLF induces annexin II by substituting for cytokines that activate downstream pathways of Ras
14627819 basic helix-loop-helix (bHLH) transcription factors, the E2A proteins (E47, E12 and E2/5), activated the human SHP promoter
14536079 E2a-Pbx1 and Bmi-1 are likely to play a role in the pathogenesis of human lymphoid leukemias through downregulation of the INK4A-ARF gene
12700034 Evidence pertaining to leukemogenesis by the well-characterized E2A-fusion proteins E2A-PBX1 and E2A-HLF is reviewed and mechanistic implications are considered.
12435739 E2A, along with histone acetyltransferases, regulates B cell development
11994467 Functional collaboration between E47 and early B cell factor enables direct targeting of the surrogate light chain VpreB promoter for trans-activation during B cell development.
7933101 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47

AA Sequence

MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFD      1 - 70
PSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSP     71 - 140
SGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTY    141 - 210
PAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHG    211 - 280
AEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFS    281 - 350
SSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLP    351 - 420
GHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGA    421 - 490
TAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERL    491 - 560
RVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVV    561 - 630
GDPQMVLSAPHPGLSEAHNPAGHM                                                  631 - 654
//

Text Mined References (191)

PMID Year Title
26942192 2016 E2A Antagonizes PU.1 Activity through Inhibition of DNA Binding.
26237075 2015 Epigenetic landscape correlates with genetic subtype but does not predict outcome in childhood acute lymphoblastic leukemia.
26223652 2015 MicroRNAs miR-155 and miR-16 Decrease AID and E47 in B Cells from Elderly Individuals.
26214592 2015 Genomics and drug profiling of fatal TCF3-HLF-positive acute lymphoblastic leukemia identifies recurrent mutation patterns and therapeutic options.
26212009 2016 PAK5-mediated E47 phosphorylation promotes epithelial-mesenchymal transition and metastasis of colon cancer.
25894862 2015 The basic helix-loop-helix transcription factor E47 reprograms human pancreatic cancer cells to a quiescent acinar state with reduced tumorigenic potential.
25778840 2015 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25659031 2015 A dynamic exchange of TCF3 and TCF4 transcription factors controls MYC expression in colorectal cancer cells.
25615280 2015 Autophagy collaborates with ubiquitination to downregulate oncoprotein E2A/Pbx1 in B-cell acute lymphoblastic leukemia.
25551271 2015 Clinical features and prognostic significance of TCF3-PBX1 fusion gene in Chinese children with acute lymphoblastic leukemia by using a modified ALL-BFM-95 protocol.
25499232 2015 Enforced expression of E47 has differential effects on Lmo2-induced T-cell leukemias.
25466284 2014 Mutations affecting the BHLHA9 DNA-binding domain cause MSSD, mesoaxial synostotic syndactyly with phalangeal reduction, Malik-Percin type.
25416956 2014 A proteome-scale map of the human interactome network.
25375219 2014 Hypomethylation-associated up-regulation of TCF3 expression and recurrence in stage II and III colorectal cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25116187 2014 Impact of TCF3 rearrangement on CNS relapse in egyptian pediatric acute lymphoblastic leukemia.
24920014 2014 A meta-analysis of Hodgkin lymphoma reveals 19p13.3 TCF3 as a novel susceptibility locus.
24596249 2014 Molecular functions of the TLE tetramerization domain in Wnt target gene repression.
24578304 2014 Outcome of TCF3-PBX1 positive pediatric acute lymphoblastic leukemia patients in Japan: a collaborative study of Japan Association of Childhood Leukemia Study (JACLS) and Children's Cancer and Leukemia Study Group (CCLSG).
24454819 2014 E2A predicts prognosis of colorectal cancer patients and regulates cancer cell growth by targeting miR-320a.
24369055 2013 E2A suppresses invasion and migration by targeting YAP in colorectal cancer cells.
24216514 2013 A recurrent dominant negative E47 mutation causes agammaglobulinemia and BCR(-) B cells.
23940558 2013 Targeted re-sequencing identified rs3106189 at the 5' UTR of TAPBP and rs1052918 at the 3' UTR of TCF3 to be associated with the overall survival of colorectal cancer patients.
23851690 2013 Induction of activation-induced cytidine deaminase-targeting adaptor 14-3-3? is mediated by NF-?B-dependent recruitment of CFP1 to the 5'-CpG-3'-rich 14-3-3? promoter and is sustained by E2A.
23812588 2013 A stable transcription factor complex nucleated by oligomeric AML1-ETO controls leukaemogenesis.
23688269 2013 Detection of E2A-PBX1 fusion transcripts in human non-small-cell lung cancer.
23555842 2013 E47 and Id1 interplay in epithelial-mesenchymal transition.
23492770 2013 TCF3, a novel positive regulator of osteogenesis, plays a crucial role in miR-17 modulating the diverse effect of canonical Wnt signaling in different microenvironments.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23135478 2013 Epithelial-mesenchymal transition-related gene expression as a new prognostic marker for neuroblastoma.
23090119 2012 Control of breast cancer growth and initiation by the stem cell-associated transcription factor TCF3.
23085504 2013 Vitamin D analog EB1089 inhibits aromatase expression by dissociation of comodulator WSTF from the CYP19A1 promoter-a new regulatory pathway for aromatase.
23063976 2012 Tcf3 and cell cycle factors contribute to butyrate resistance in colorectal cancer cells.
22972921 2012 Inhibitors of DNA binding proteins restrict T cell potential by repressing Notch1 expression in Flt3-negative common lymphoid progenitors.
22829926 2012 Protein inhibitor of activated STAT, PIASy regulates ?-smooth muscle actin expression by interacting with E12 in mesangial cells.
22743623 2012 Oncogenic fusion E2A-HLF sensitizes t(17;19)-positive acute lymphoblastic leukemia to TRAIL-mediated apoptosis by upregulating the expression of death receptors.
22564737 2012 Increased expression of bHLH transcription factor E2A (TCF3) in prostate cancer promotes proliferation and confers resistance to doxorubicin induced apoptosis.
22544934 2012 E2A and CBP/p300 act in synergy to promote chromatin accessibility of the immunoglobulin ? locus.
22514271 2012 Cyclic AMP signaling inhibits megakaryocytic differentiation by targeting transcription factor 3 (E2A) cyclin-dependent kinase inhibitor 1A (CDKN1A) transcriptional axis.
22387215 2012 E2A proteins enhance the histone acetyltransferase activity of the transcriptional co-activators CBP and p300.
22354994 2012 Biochemical and phosphoproteomic analysis of the helix-loop-helix protein E47.
22207202 2012 Mapping acetylation sites in E2A identifies a conserved lysine residue in activation domain 1 that promotes CBP/p300 recruitment and transcriptional activation.
21869488 2011 RT-PCR and real-time PCR analysis of E2A-PBX1, TEL-AML1, mBCR-ABL and MLL-AF4 fusion gene transcripts in de novo B-lineage acute lymphoblastic leukaemia patients in south India.
21832153 2011 Cross-talk between distinct nuclear import pathways enables efficient nuclear import of E47 in conjunction with its partner transcription factors.
21828274 2011 HEB and E2A function as SMAD/FOXH1 cofactors.
21788410 2011 Genomic loss of the putative tumor suppressor gene E2A in human lymphoma.
21655267 2011 Transcription factors E2A, FOXO1 and FOXP1 regulate recombination activating gene expression in cancer cells.
21551245 2011 The B lineage transcription factor E2A regulates apoptosis in chronic lymphocytic leukemia (CLL) cells.
21534874 2011 Prognostic impact of t(1;19)/ TCF3-PBX1 in childhood acute lymphoblastic leukemia in the context of Berlin-Frankfurt-Münster-based protocols.
21498546 2011 The Id3/E47 axis mediates cell-cycle control in human pancreatic ducts and adenocarcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21285352 2011 Phosphorylation of TCF proteins by homeodomain-interacting protein kinase 2.
21258409 2011 miR-495 is upregulated by E12/E47 in breast cancer stem cells, and promotes oncogenesis and hypoxia resistance via downregulation of E-cadherin and REDD1.
21212793 2011 E2A is a transcriptional regulator of CD38 expression in chronic lymphocytic leukemia.
21179004 2011 Differential genomic targeting of the transcription factor TAL1 in alternate haematopoietic lineages.
20802470 2010 E2A-positive gastric MALT lymphoma has weaker plasmacytoid infiltrates and stronger expression of the memory B-cell-associated miR-223: possible correlation with stage and treatment response.
20519628 2010 Aberrant induction of LMO2 by the E2A-HLF chimeric transcription factor and its implication in leukemogenesis of B-precursor ALL with t(17;19).
20217071 2010 Impact of female cigarette smoking on circulating B cells in vivo: the suppressed ICOSLG, TCF3, and VCAM1 gene functional network may inhibit normal cell function.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20050020 2009 Hedgehog signaling maintains hair follicle stem cell phenotype in young and aged human skin.
20022378 2010 Calmodulin inhibition of E2A stops expression of surrogate light chains of the pre-B-cell receptor and CD19.
19801649 2009 Mixed lineage kinase phosphorylates transcription factor E47 and inhibits TrkB expression to link neuronal death and survival pathways.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19362560 2009 The basic helix-loop-helix transcription factor scleraxis regulates fibroblast collagen synthesis.
19323994 2009 LMO4 controls the balance between excitatory and inhibitory spinal V2 interneurons.
19299559 2009 MyoD and E-protein heterodimers switch rhabdomyosarcoma cells from an arrested myoblast phase to a differentiated state.
19125693 2009 Human calcium/calmodulin-dependent serine protein kinase regulates the expression of p21 via the E2A transcription factor.
18727914 2008 Regulation of the bHLH transcription factor E2A in epithelial cells by interaction with the Na/K-ATPase beta1 subunit.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18455790 2008 BCR-ABL, ETV6-RUNX1 and E2A-PBX1: prevalence of the most common acute lymphoblastic leukemia fusion genes in Mexican patients.
18390709 2008 Aging down-regulates the transcription factor E2A, activation-induced cytidine deaminase, and Ig class switch in human B cells.
18185522 2008 E2A-ZNF384 and NOL1-E2A fusion created by a cryptic t(12;19)(p13.3; p13.3) in acute leukemia.
17467953 2007 Nine-amino-acid transactivation domain: establishment and prediction utilities.
17426122 2007 Selective use of multiple vitamin D response elements underlies the 1 alpha,25-dihydroxyvitamin D3-mediated negative regulation of the human CYP27B1 gene.
17311319 2007 Molecular cytogenetic characterization of TCF3 (E2A)/19p13.3 rearrangements in B-cell precursor acute lymphoblastic leukemia.
17272506 2007 Growth factor independent 1B (Gfi1b) is an E2A target gene that modulates Gata3 in T-cell lymphomas.
17183364 2007 Hypercalcemia in childhood acute lymphoblastic leukemia: frequent implication of parathyroid hormone-related peptide and E2A-HLF from translocation 17;19.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16814783 2006 Overexpression of E2A proteins induces epithelial-mesenchymal transition in human renal proximal tubular epithelial cells suggesting a potential role in renal fibrosis.
16782810 2006 Gene expression patterns define novel roles for E47 in cell cycle progression, cytokine-mediated signaling, and T lineage development.
16769578 2006 The effects of siRNA-mediated inhibition of E2A-PBX1 on EB-1 and Wnt16b expression in the 697 pre-B leukemia cell line.
16705184 2006 E Proteins and Id2 converge on p57Kip2 to regulate cell cycle in neural cells.
16546275 Activin A-induced expression of PAX4 in AR42J-B13 cells involves the increase in transactivation of E47/E12.
16449526 2006 Notch1 promotes survival of E2A-deficient T cell lymphomas through pre-T cell receptor-dependent and -independent mechanisms.
16428437 2006 E2A and IRF-4/Pip promote chromatin modification and transcription of the immunoglobulin kappa locus in pre-B cells.
16215946 2005 [Detection of fusion genes resulting from chromosome abnormalities in childhood acute lymphoblastic leukemia].
16206189 2006 ABCB1 over-expression and drug-efflux in acute lymphoblastic leukemia cell lines with t(17;19) and E2A-HLF expression.
16055439 2005 Sterol regulatory element-binding proteins activate insulin gene promoter directly and indirectly through synergy with BETA2/E47.
16043483 2005 MEF2-dependent recruitment of the HAND1 transcription factor results in synergistic activation of target promoters.
16007194 2005 E12 and E47 modulate cellular localization and proteasome-mediated degradation of MyoD and Id1.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15555546 2004 Snail regulates p21(WAF/CIP1) expression in cooperation with E2A and Twist.
15509787 2004 Differential regulation of Hand1 homodimer and Hand1-E12 heterodimer activity by the cofactor FHL2.
15507449 2004 E2A-PBX1 interacts directly with the KIX domain of CBP/p300 in the induction of proliferation in primary hematopoietic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351717 2004 Differential cooperation between dHAND and three different E-proteins.
15333839 2004 E protein silencing by the leukemogenic AML1-ETO fusion protein.
15310760 2004 Differential functions for the transcription factor E2A in positive and negative gene regulation in pre-B lymphocytes.
15280352 2004 Calcium/calmodulin inhibition of transcriptional activity of E-proteins by prevention of their binding to DNA.
15242870 2004 E47, IRF-4, and PU.1 synergize to induce B-cell-specific activation of the class II transactivator promoter III (CIITA-PIII).
15138269 2004 Regulation of cellular senescence and p16(INK4a) expression by Id1 and E47 proteins in human diploid fibroblast.
15070701 2004 Regulation of annexin II by cytokine-initiated signaling pathways and E2A-HLF oncoprotein.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15044608 2004 Increased expression of the FIGLA transcription factor is associated with primordial follicle formation in the human fetal ovary.
15030778 2004 Long-term cultured E2A-deficient hematopoietic progenitor cells are pluripotent.
14752053 2004 Orphan nuclear receptor small heterodimer partner, a novel corepressor for a basic helix-loop-helix transcription factor BETA2/neuroD.
14627819 2003 Synergistic activation of the human orphan nuclear receptor SHP gene promoter by basic helix-loop-helix protein E2A and orphan nuclear receptor SF-1.
14592976 2003 Notch-induced E2A ubiquitination and degradation are controlled by MAP kinase activities.
14576336 2004 Neurogenin3 activates the islet differentiation program while repressing its own expression.
14536079 2003 Bmi-1 regulation of INK4A-ARF is a downstream requirement for transformation of hematopoietic progenitors by E2a-Pbx1.
12700034 2003 E2A basic helix-loop-helix transcription factors in human leukemia.
12566462 2003 Regulation of pT alpha gene expression by a dosage of E2A, HEB, and SCL.
12493738 2003 Basic helix-loop-helix transcription factor epicardin/capsulin/Pod-1 suppresses differentiation by negative regulation of transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435739 2003 Regulation of E2A activities by histone acetyltransferases in B lymphocyte development.
12217327 2002 N-twist, an evolutionarily conserved bHLH protein expressed in the developing CNS, functions as a transcriptional inhibitor.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
12107263 2002 Aberrant localization of beta-catenin correlates with overexpression of its target gene in human papillary thyroid cancer.
11994467 2002 The human V-preB promoter is a target for coordinated activation by early B cell factor and E47.
11940670 2002 Notch signaling induces rapid degradation of achaete-scute homolog 1.
11812799 2002 The basic helix-loop-helix factor, HAND2, functions as a transcriptional activator by binding to E-boxes as a heterodimer.
11802795 2002 Human Hand1 basic helix-loop-helix (bHLH) protein: extra-embryonic expression pattern, interaction partners and identification of its transcriptional repressor domains.
11509675 2001 Promotion of cell cycle progression by basic helix-loop-helix E2A.
11237058 2001 The leukemogenic transcription factor E2a-Pbx1 induces expression of the putative N-myc and p53 target gene NDRG1 in Ba/F3 cells.
10958665 2000 Functions of E2A-HEB heterodimers in T-cell development revealed by a dominant negative mutation of HEB.
10924525 2000 The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function.
10915743 2000 Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression.
10866689 2000 A pentamer transcriptional complex including tal-1 and retinoblastoma protein downmodulates c-kit expression in normal erythroblasts.
10781029 2000 Serine/Threonine kinases 3pK and MAPK-activated protein kinase 2 interact with the basic helix-loop-helix transcription factor E47 and repress its transcriptional activity.
10775504 2000 Regulation of scleraxis function by interaction with the bHLH protein E47.
10768861 2000 Role of the basic helix-loop-helix transcription factor p48 in the differentiation phenotype of exocrine pancreas cancer cells.
10757985 2000 A novel type of calmodulin interaction in the inhibition of basic helix-loop-helix transcription factors.
10749989 2000 Saethre-Chotzen mutations cause TWIST protein degradation or impaired nuclear location.
10636926 2000 Transcription factor BETA2 acts cooperatively with E2A and PDX1 to activate the insulin gene promoter.
10567574 1999 Bridge-1, a novel PDZ-domain coactivator of E2A-mediated regulation of insulin gene transcription.
10545951 1999 Mutations in NEUROD1 are associated with the development of type 2 diabetes mellitus.
10502414 1999 Dimerization of the docking/adaptor protein HEF1 via a carboxy-terminal helix-loop-helix domain.
10497239 1999 Characterization of the mUBC9-binding sites required for E2A protein degradation.
10471746 1999 A conserved motif N-terminal to the DNA-binding domains of myogenic bHLH transcription factors mediates cooperative DNA binding with pbx-Meis1/Prep1.
10086727 1999 Identification of a novel molecular partner of the E2A gene in childhood leukemia.
9742120 1998 The AD1 and AD2 transactivation domains of E2A are essential for the antiapoptotic activity of the chimeric oncoprotein E2A-HLF.
9624159 1998 Aortic carboxypeptidase-like protein, a novel protein with discoidin and carboxypeptidase-like domains, is up-regulated during vascular smooth muscle cell differentiation.
9584154 1998 Characterization of ABF-1, a novel basic helix-loop-helix transcription factor expressed in activated B lymphocytes.
9582372 1998 A conserved C-terminal domain in PBX increases DNA binding by the PBX homeodomain and is not a primary site of contact for the YPWM motif of HOXA1.
9525934 1998 Lymphoid-specific expression of the Id3 gene in hematopoietic cells. Selective antagonism of E2A basic helix-loop-helix protein associated with Id3-induced differentiation of erythroleukemia cells.
9507011 1998 The Tal1 oncoprotein inhibits E47-mediated transcription. Mechanism of inhibition.
9418854 1998 Multiple roles for the MyoD basic region in transmission of transcriptional activation signals and interaction with MEF2.
9409784 1997 The mUBC9 murine ubiquitin conjugating enzyme interacts with the E2A transcription factors.
9242638 1997 Differential interactions of Id proteins with basic-helix-loop-helix transcription factors.
9235903 1997 Novel regulation of the helix-loop-helix protein Id1 by S5a, a subunit of the 26 S proteasome.
9214632 1997 The LIM-only protein Lmo2 is a bridging molecule assembling an erythroid, DNA-binding complex which includes the TAL1, E47, GATA-1 and Ldb1/NLI proteins.
9209374 1997 LIM-only protein Lmo2 forms a protein complex with erythroid transcription factor GATA-1.
9199284 1997 Transcriptional synergy between LIM-homeodomain proteins and basic helix-loop-helix proteins: the LIM2 domain determines specificity.
9184158 1997 MyoD-E12 heterodimers and MyoD-MyoD homodimers are equally stable.
9073453 1997 Mist1: a novel basic helix-loop-helix transcription factor exhibits a developmentally regulated expression pattern.
9001211 1997 Mos activates myogenic differentiation by promoting heterodimerization of MyoD and E12 proteins.
8999959 1997 Physical and functional interactions between the transcriptional inhibitors Id3 and ITF-2b. Evidence toward a novel mechanism regulating muscle-specific gene expression.
8948587 1996 Restricted expression of a novel murine atonal-related bHLH protein in undifferentiated neural precursors.
8918463 1996 Net (ERP/SAP2) one of the Ras-inducible TCFs, has a novel inhibitory domain with resemblance to the helix-loop-helix motif.
8900141 1996 Cooperative transcriptional activation by the neurogenic basic helix-loop-helix protein MASH1 and members of the myocyte enhancer factor-2 (MEF2) family.
8759016 1996 E2A basic-helix-loop-helix transcription factors are negatively regulated by serum growth factors and by the Id3 protein.
8628307 1996 Helix-loop-helix proteins LYL1 and E2a form heterodimeric complexes with distinctive DNA-binding properties in hematolymphoid cells.
8617811 1996 Physical interaction between the mitogen-responsive serum response factor and myogenic basic-helix-loop-helix proteins.
8433970 1993 Proposed structure for the DNA-binding domain of the helix-loop-helix family of eukaryotic gene regulatory proteins.
8432525 1993 Fluorescence in situ hybridization mapping of human chromosome 19: cytogenetic band location of 540 cosmids and 70 genes or DNA markers.
8164688 1994 DNA-binding specificity and trans-activating potential of the leukemia-associated E2A-hepatic leukemia factor fusion protein.
8159721 1994 Formation of in vivo complexes between the TAL1 and E2A polypeptides of leukemic T cells.
8152805 1994 Products of the TAL2 oncogene in leukemic T cells: bHLH phosphoproteins with DNA-binding activity.
8001125 1994 E2A proteins are required for proper B cell development and initiation of immunoglobulin gene rearrangements.
7935390 1994 Isolation and characterization of a novel transcription factor that binds to and activates insulin control element-mediated expression.
7933101 1994 Role of flanking E box motifs in human immunodeficiency virus type 1 TATA element function.
7623842 1995 B-cell-specific DNA binding by an E47 homodimer.
7568177 1995 Association of erythroid transcription factors: complexes involving the LIM protein RBTN2 and the zinc-finger protein GATA1.
2799390 1989 The gene for enhancer binding proteins E12/E47 lies at the t(1;19) breakpoint in acute leukemias.
2503252 1989 Interactions between heterologous helix-loop-helix proteins generate complexes that bind specifically to a common DNA sequence.
2493990 1989 A new DNA binding and dimerization motif in immunoglobulin enhancer binding, daughterless, MyoD, and myc proteins.
2385294 1990 Transcriptional activation domain of the muscle-specific gene-regulatory protein myf5.
2308859 1990 Sequence of the cDNA encoding ITF-1, a positive-acting transcription factor.
2163343 1990 Myogenin resides in the nucleus and acquires high affinity for a conserved enhancer element on heterodimerization.
2112746 1990 Mutations that disrupt DNA binding and dimer formation in the E47 helix-loop-helix protein map to distinct domains.
2105528 1990 Two distinct transcription factors that bind the immunoglobulin enhancer microE5/kappa 2 motif.
1967983 1990 A new homeobox gene contributes the DNA binding domain of the t(1;19) translocation protein in pre-B ALL.
1967982 1990 Chromosomal translocation t(1;19) results in synthesis of a homeobox fusion mRNA that codes for a potential chimeric transcription factor.
1818757 1991 Sequence of a HeLa cDNA provides the DNA binding domain and carboxy terminus of HE47: a human helix-loop-helix protein related to the enhancer binding factor E47.
1720355 1991 Nuclear targeting of the transcription factor PTF1 is mediated by a protein subunit that does not bind to the PTF1 cognate sequence.
1671560 1991 The t(1;19)(q23;p13) results in consistent fusion of E2A and PBX1 coding sequences in acute lymphoblastic leukemias.
1649701 1991 Functional activity of myogenic HLH proteins requires hetero-oligomerization with E12/E47-like proteins in vivo.
1386162 1992 Fusion of the leucine zipper gene HLF to the E2A gene in human acute B-lineage leukemia.
1325437 1992 Analysis of the oligomerization of myogenin and E2A products in vivo using a two-hybrid assay system.