Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 416 3.4e-04

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.100 3.4e-04

AA Sequence

MDRGRPAGSPLSASAEPAPLAAAIRDSRPGRTGPGPAGPGGGSRSGSGRPAAANAARERSRVQTLRHAFL      1 - 70
ELQRTLPSVPPDTKLSKLDVLLLATTYIAHLTRSLQDDAEAPADAGLGALRGDGYLHPVKKWPMRSRLYI     71 - 140
GATGQFLKHSVSGEKTNHDNTPTDSQP                                               141 - 167
//

Text Mined References (2)

PMID Year Title