Property Summary

NCBI Gene PubMed Count 35
PubMed Score 57.80
PubTator Score 41.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
cystic fibrosis 1.883 7.6e-06
adrenocortical adenoma -1.022 4.4e-04
adrenocortical carcinoma -1.779 3.7e-16
non-small cell lung cancer -3.924 6.2e-41
intraductal papillary-mucinous adenoma (... -2.700 1.3e-04
intraductal papillary-mucinous carcinoma... -3.200 5.4e-05
intraductal papillary-mucinous neoplasm ... -3.100 1.5e-03
lung cancer -3.400 1.5e-05
lung adenocarcinoma -2.690 6.3e-12
aldosterone-producing adenoma -1.424 5.7e-03
lung carcinoma -3.400 1.4e-21
ovarian cancer -4.000 7.1e-20
head and neck cancer -1.600 4.4e-02
psoriasis -1.500 2.7e-09

Synonym

Accession O43680 E1P581 O43545 Q6ICV0 Q9BZ14 TCF-21
Symbols POD1
bHLHa23

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

Pathway (1)

Gene RIF (20)

PMID Text
26435499 TCF21 may function as a tumor suppressor gene, which is downregulated through promoter hypermethylation in CRC development.
26421305 These findings show that POD-1/TCF21 regulates SF-1 and LRH-1 by distinct mechanisms, contributing to the understanding of POD-1 involvement and its mechanisms of action in adrenal and liver tumorigenesis.
26158413 The presence of significant hypermethylation of TCF21 supports the hypothesis that hypermethylation of TCF21 and/or decreased TARID expression lies within the pathogenic pathway of most CCSKs.
26146055 TCF21 could inhibit the proliferation and migration of SMMC-7721 hepatocellular carcinoma cells and promote its apoptosis
26044559 our data provided the first evidence that TCF21 mRNA is significantly downregulated in breast cancer cell lines and tissues and regulates breast cancer cell proliferation and EMT.
26020271 Separate enrichment analyses found over-representation of TCF21 target genes among CAD associated genes, and linkage disequilibrium between TCF21 peak variation and that found in GWAS loci consistent with the hypothesis that TCF21 may affect disease risk
25156819 Low TCF21 expression is associated with gastric cancer.
25087872 Results show that TARID, an antisense lncRNA activates TCF21 expression by inducing promoter demethylation.
24758904 TCF21 inhibits the proliferation and migration and facilitates early apoptosis of A549 cells.
24676100 these data suggest that miR-224 interaction with the TCF21 transcript contributes to allelic imbalance of this gene, thus partly explaining the genetic risk for coronary heart disease associated at 6q23.2
23874238 Thus, both disease-related growth factor and embryonic signaling pathways may regulate CHD risk through two independent alleles at TCF21.
23529585 These findings, together with its stage- and primary site-dependent expression, turn TCF21 into a promising candidate biomarker in head and neck squamous cell carcinoma.
23313103 study found that POD-1/TCF21 acts as a transcriptional suppressor of SF-1 gene expression in adrenocortical carcinoma cells; a possible mechanism involved in repression of SF-1 expression is through POD-1 binding to the E-box sequence in the SF-1 promoter region
22862160 demonstrated that TCF21 was a significant prognosticator of cancer-specific survival
21771727 Epigenetic downregulation of TCF21 is functionally involved in melanoma progression.
20945327 Hypermethylation and decreased expression of TCF21 were tumor specific and very frequent in all NSCLCs, even early-stage disease.
20634891 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
16415157 analysis of TCF21 epigenetic regulation on 6q23-q24 in lung and head and neck cancer
12493738 epicardin/capsulin/Pod-1 functions as a negative regulator of differentiation of myoblasts through transcription in cell growth arrest and lineage-specific differentiation

AA Sequence

MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLS      1 - 70
GVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKY     71 - 140
ENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS                                   141 - 179
//

Text Mined References (35)

PMID Year Title
26435499 2016 Down-regulation of TCF21 by hypermethylation induces cell proliferation, migration and invasion in colorectal cancer.
26421305 2015 POD-1/TCF21 Reduces SHP Expression, Affecting LRH-1 Regulation and Cell Cycle Balance in Adrenocortical and Hepatocarcinoma Tumor Cells.
26158413 2015 TCF21 hypermethylation in genetically quiescent clear cell sarcoma of the kidney.
26146055 2015 [Over-expression of transcription factor 21 inhibits the proliferation and migration and promotes apoptosis of SMMC-7721 cells].
26044559 2015 Clinicopathological significance and biological role of TCF21 mRNA in breast cancer.
26020271 2015 Characterization of TCF21 Downstream Target Regions Identifies a Transcriptional Network Linking Multiple Independent Coronary Artery Disease Loci.
25156819 2015 Protein expression and promoter methylation of the candidate biomarker TCF21 in gastric cancer.
25087872 2014 Long noncoding RNA TARID directs demethylation and activation of the tumor suppressor TCF21 via GADD45A.
24758904 2014 [Effects of tumor suppressor gene TCF21 on the proliferation, migration and apoptosis of A549 cells].
24676100 2014 Coronary heart disease-associated variation in TCF21 disrupts a miR-224 binding site and miRNA-mediated regulation.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23874238 2013 Disease-related growth factor and embryonic signaling pathways modulate an enhancer of TCF21 expression at the 6q23.2 coronary heart disease locus.
23529585 2013 Protein expression and promoter methylation of the candidate biomarker TCF21 in head and neck squamous cell carcinoma.
23313103 2013 POD-1 binding to the E-box sequence inhibits SF-1 and StAR expression in human adrenocortical tumor cells.
22862160 2012 Down-regulation of TCF21 is associated with poor survival in clear cell renal cell carcinoma.
22751097 2012 Genome-wide association study in Han Chinese identifies four new susceptibility loci for coronary artery disease.
21771727 2011 Epigenetic deregulation of TCF21 inhibits metastasis suppressor KISS1 in metastatic melanoma.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
20945327 2011 Methylation of the candidate biomarker TCF21 is very frequent across a spectrum of early-stage nonsmall cell lung cancers.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
16415157 2006 Epigenetic regulation of the tumor suppressor gene TCF21 on 6q23-q24 in lung and head and neck cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12493738 2003 Basic helix-loop-helix transcription factor epicardin/capsulin/Pod-1 suppresses differentiation by negative regulation of transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
10572052 1999 The basic-helix-loop-helix protein pod1 is critically important for kidney and lung organogenesis.
9733105 1998 epicardin: A novel basic helix-loop-helix transcription factor gene expressed in epicardium, branchial arch myoblasts, and mesenchyme of developing lung, gut, kidney, and gonads.
9545526 1998 Cloning of capsulin, a basic helix-loop-helix factor expressed in progenitor cells of the pericardium and the coronary arteries.
9507058 1998 Pod-1, a mesoderm-specific basic-helix-loop-helix protein expressed in mesenchymal and glomerular epithelial cells in the developing kidney.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7553065 1995 Transcription factors 2: helix-loop-helix.