Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.70
PubTator Score 3.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.800 1.4e-03
oligodendroglioma -2.000 3.2e-03
glioblastoma -2.500 5.7e-10
posterior fossa group A ependymoma -2.600 2.0e-12
atypical teratoid / rhabdoid tumor -1.500 1.1e-02
adult high grade glioma -2.600 8.8e-07
group 3 medulloblastoma -2.800 4.9e-05
pilocytic astrocytoma -2.900 4.8e-11
pituitary cancer 1.100 4.0e-02

Gene RIF (4)

PMID Text
22791750 TCERG1L is associated with plasma adiponectin, a key modulator of obesity, inflammation, IR and diabetes.
20732627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQAGARFQRRRRQLQQQQPRRRQPLLWPMDAEPPPPPPWVWMVPGSAGLLRLSAGVVVPPVLLASAPPPA      1 - 70
APLLPGLPGWPAPSEPVLPLLPLPSAPDSAAAAAAHPFPALHGQWLFGGHSPSLGLPPSSTVELVPVFPH     71 - 140
LCPSALATPIGKSWIDKRIPNCKIFFNNSFALDSTWIHPEESRFFHGHEKPRLLANQVAVSLSRPAPASR    141 - 210
PLPTVVLAPQPIPGGCHNSLKVTSSPAIAIATAAAAAMVSVDPENLRGPSPSSVQPRHFLTLAPIKIPLR    211 - 280
TSPVSDTRTERGRVARPPALMLRAQKSRDGDKEDKEPPPMLGGGEDSTARGNRPVASTPVPGSPWCVVWT    281 - 350
GDDRVFFFNPTMHLSVWEKPMDLKDRGDLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNR    351 - 420
TEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIVFDPRYLLLNS    421 - 490
EERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQ    491 - 560
EHFFNQFILILKKRDKENRLRLRKMR                                                561 - 586
//

Text Mined References (13)

PMID Year Title
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22791750 2012 Genome-wide association study identifies novel loci association with fasting insulin and insulin resistance in African Americans.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
20732627 2010 Case-control genome-wide association study of attention-deficit/hyperactivity disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.