Property Summary

NCBI Gene PubMed Count 37
PubMed Score 176.33
PubTator Score 41.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Gene RIF (21)

PMID Text
26873599 TCERG1 binds independently to elongation and splicing complexes, thus performing their coupling by transient interactions rather than by stable association with one or the other complexes.
26462236 TCERG1 sensitizes a cell to apoptotic agents, thus promoting apoptosis by regulating the alternative splicing of both the Bcl-x and Fas/CD95 genes.
24165037 This study reveals that TCERG1 regulates HIV-1 transcriptional elongation by increasing the elongation rate of RNAPII and phosphorylation of Ser 2 within the carboxyl-terminal domain.
24165037 Both CA150 and HIV-1 Tat associate with the RNA polymerase II holoenzyme and are required for Tat transactivation of the HIV-1 LTR promoter
23436654 Specific interaction of the transcription elongation regulator TCERG1 with RNA polymerase II requires simultaneous phosphorylation at Ser2, Ser5, and Ser7 within the carboxyl-terminal domain repeat.
22453921 The FF4 and FF5 domains of transcription elongation regulator 1 (TCERG1) target proteins to the periphery of speckles.
22158966 We propose that TCERG1 modulates the elongation rate of RNAPII to relieve pausing, thereby activating the proapoptotic Bcl-x(S) 5' splice site.
21503969 TCERG1 can inhibit C/EBPalpha activity regardless of the latter's location in the nucleus
20215116 mutation of the SUMO acceptor lysine residues enhanced TCERG1 transcriptional activity, indicating that SUMO modification negatively regulates TCERG1 transcriptional activity
19966273 Both CA150 and HIV-1 Tat associate with the RNA polymerase II holoenzyme and are required for Tat transactivation of the HIV-1 LTR promoter
19845895 Observational study of gene-disease association. (HuGE Navigator)
19715701 Data gave a model for FF domain organization within tandem arrays suggests a general mechanism by which individual FF domains can manoeuvre to achieve optimal recognition of flexible binding partners, such as the intrinsically-disordered phosphoCTD
19660470 Data provide the first crystal structure of an FF domain and insights into the tandem nature of the FF domains and suggest that, in addition to protein binding, FF domains might be involved in DNA binding.
18187414 The interferon consensus sequence-binding protein (ICSBP/IRF8) represses PTPN13 gene transcription in differentiating myeloid cells
17018562 GRIN2A and TCERG1 may show true association with residual age of onset for Huntington's disease in genetic association tests in 443 affected people from a large set of kindreds from Venezuela.
16782886 Sequences located at both the amino and carboxyl regions of CA150 are required to assemble transcription/splicing complexes, which may be involved in the coupling of those processes.
16644732 CA150 is a co-repressor of C/EBP proteins and provides a possible mechanism for how C/EBPalpha can repress transcription of specific genes
15456888 Results suggest an essential role of WW/FF domain-containing factors such as FBP11 and CA150 in pre-mRNA splicing that likely occurs in concert with transcription in vivo.
12821179 Specific alleles in GluR6 and CA150 locus were only observed in HD patients.
10373521 Both CA150 and HIV-1 Tat associate with the RNA polymerase II holoenzyme and are required for Tat transactivation of the HIV-1 LTR promoter
9315662 Both CA150 and HIV-1 Tat associate with the RNA polymerase II holoenzyme and are required for Tat transactivation of the HIV-1 LTR promoter

AA Sequence

MAERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPPPPPRPPFGRP      1 - 70
PFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMPPVTAPGTPALPPTEEIWVEN     71 - 140
KTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQ    141 - 210
AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPS    211 - 280
STTSTTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQ    281 - 350
PTTAIPAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIA    351 - 420
ASPATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEPSEEPLPMETE    421 - 490
EEDPKEEPIKEIKEEPKEEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPD    491 - 560
DLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKR    561 - 630
DDNKDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPK    631 - 700
ERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDRE    701 - 770
ALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLF    771 - 840
KQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDM    841 - 910
VRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEV    911 - 980
KKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKI    981 - 1050
LQNDKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK                         1051 - 1098
//

Text Mined References (45)

PMID Year Title
26873599 2016 The in vivo dynamics of TCERG1, a factor that couples transcriptional elongation with splicing.
26462236 2015 Functional Consequences for Apoptosis by Transcription Elongation Regulator 1 (TCERG1)-Mediated Bcl-x and Fas/CD95 Alternative Splicing.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24165037 2013 Transcription elongation regulator 1 (TCERG1) regulates competent RNA polymerase II-mediated elongation of HIV-1 transcription and facilitates efficient viral replication.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23436654 2013 Specific interaction of the transcription elongation regulator TCERG1 with RNA polymerase II requires simultaneous phosphorylation at Ser2, Ser5, and Ser7 within the carboxyl-terminal domain repeat.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22453921 2012 The FF4 and FF5 domains of transcription elongation regulator 1 (TCERG1) target proteins to the periphery of speckles.
22158966 2012 TCERG1 regulates alternative splicing of the Bcl-x gene by modulating the rate of RNA polymerase II transcription.
21503969 2011 TCERG1 inhibits C/EBP? through a mechanism that does not involve sequestration of C/EBP? at pericentromeric heterochromatin.
21269460 2011 Initial characterization of the human central proteome.
20956529 2010 Transcription elongation regulator 1 is a co-integrator of the cell fate determination factor Dachshund homolog 1.
20215116 2010 Differential effects of sumoylation on transcription and alternative splicing by transcription elongation regulator 1 (TCERG1).
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
19715701 2009 Structural studies of FF domains of the transcription factor CA150 provide insights into the organization of FF domain tandem arrays.
19660470 2009 Crystal structure of the three tandem FF domains of the transcription elongation regulator CA150.
18187414 2008 Identification of the cellular targets of the transcription factor TCERG1 reveals a prevalent role in mRNA processing.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17060612 2006 General structural motifs of amyloid protofilaments.
17018562 2007 Replication of twelve association studies for Huntington's disease residual age of onset in large Venezuelan kindreds.
16782886 2006 Human transcription elongation factor CA150 localizes to splicing factor-rich nuclear speckles and assembles transcription and splicing components into complexes through its amino and carboxyl regions.
16644732 2006 Identification of a co-repressor that inhibits the transcriptional and growth-arrest activities of CCAAT/enhancer-binding protein alpha.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485897 2004 FF domains of CA150 bind transcription and splicing factors through multiple weak interactions.
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15296517 2004 Identification of genes differentially expressed in T cells following stimulation with the chemokines CXCL12 and CXCL10.
14672652 2004 Dephosphorylation of RNA polymerase II by CTD-phosphatase FCP1 is inhibited by phospho-CTD associating proteins.
12821179 2003 Modulation of age at onset in Huntington's disease and spinocerebellar ataxia type 2 patients originated from eastern India.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376575 2002 Hyperphosphorylated C-terminal repeat domain-associating proteins in the nuclear proteome link transcription to DNA/chromatin modification and RNA processing.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11604498 2001 The transcription elongation factor CA150 interacts with RNA polymerase II and the pre-mRNA splicing factor SF1.
11172033 2001 The Gln-Ala repeat transcriptional activator CA150 interacts with huntingtin: neuropathologic and genetic evidence for a role in Huntington's disease pathogenesis.
11003711 2000 Expression analysis and mapping of the mouse and human transcriptional regulator CA150.
10908677 2000 Protein-interaction modules that organize nuclear function: FF domains of CA150 bind the phosphoCTD of RNA polymerase II.
10373521 1999 Transcriptional cofactor CA150 regulates RNA polymerase II elongation in a TATA-box-dependent manner.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
9315662 1997 CA150, a nuclear protein associated with the RNA polymerase II holoenzyme, is involved in Tat-activated human immunodeficiency virus type 1 transcription.