Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.18
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.0e-07
non primary Sjogren syndrome sicca 891 1.7e-02

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 1.7e-02
osteosarcoma -2.682 2.0e-07

Synonym

Accession Q8N8B7 A6NI06 B2RDM3
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MSDKNQIAARASLIEQLMSKRNFEDLGNHLTELETIYVTKEHLQETDVVRAVYRVLKNCPSVALKKKAKC      1 - 70
LLSKWKAVYKQTHSKARNSPKLFPVRGNKEENSGPSHDPSQNETLGICSSNSLSSQDVAKLSEMIVPENR     71 - 140
AIQLKPKEEHFGDGDPESTGKRSSELLDPTTPMRTKCIELLYAALTSSSTDQPKADLWQNFAREIEEHVF    141 - 210
TLYSKNIKKYKTCIRSKVANLKNPRNSHLQQNLLSGTTSPREFAEMTVMEMANKELKQLRASYTESCIQE    211 - 280
HYLPQVIDGTQTNKIKCRRCEKYNCKVTVIDRGTLFLPSWVRNSNPDEQMMTYVICNECGEQWYHSKWVC    281 - 350
W//

Text Mined References (6)

PMID Year Title