Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Duchenne muscular dystrophy 1.236 1.3e-08
autosomal dominant Emery-Dreifuss muscul... 1.044 1.9e-03
juvenile dermatomyositis 1.196 2.0e-10
diabetes mellitus -1.100 1.2e-03
Breast cancer 2.800 2.5e-02
ovarian cancer -2.000 1.4e-04

Synonym

Accession Q8IYN2 TCEA-like protein 8
Symbols WEX3

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
10051408 Characterizes TCEAL1, another member of the human TCEAL gene family.

AA Sequence

MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHL      1 - 70
DPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP                            71 - 117
//

Text Mined References (5)

PMID Year Title
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10051408 1999 Genomic structure and chromosomal localization of TCEAL1, a human gene encoding the nuclear phosphoprotein p21/SIIR.