Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.61
PubTator Score 9.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Synonym

Accession Q9BRU2 B3KSV2 Q96AT4 TCEA-like protein 7
Symbols WEX5
MPMGp800C04260Q003

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
23372750 Our study suggests that TCEAL7 might serve as a candidate tumor suppressor and a potential prognostic biomarker in gastric carcinogenesis.
20454512 alteration of TCEAL7 expression levels in recombination-based alternative lengthening of telomeres and telomerase-positive cells affects hTERT expression
19966855 TCEAL7 in the negative regulation of NF-kappaB signaling at the basal level by modulating transcriptional activity of NF-kappaB on its target gene promoters in ovarian cells.
19419758 TCEAL7 polymorphisms may play a role in the development of invasive serous ovarian cancers.
19419758 Observational study of gene-disease association. (HuGE Navigator)
18806825 A role for candidate tumor-suppressor gene TCEAL7 in the regulation of c-Myc activity, cyclin D1 levels and cellular transformation is reported.
15870691 TCEAL7 is a cell death regulatory protein that is frequently inactivated in ovarian cancers, and may function as a tumor suppressor.

AA Sequence

MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEME      1 - 70
RCLEEIRGLRKKFRALHSNHRHSRDRPYPI                                             71 - 100
//

Text Mined References (12)

PMID Year Title
23372750 2013 Decreased expression of transcription elongation factor A-like 7 is associated with gastric adenocarcinoma prognosis.
20454512 2010 TCEAL7 inhibition of c-Myc activity in alternative lengthening of telomeres regulates hTERT expression.
19966855 2010 TCEAL7, a putative tumor suppressor gene, negatively regulates NF-kappaB pathway.
19419758 2009 Polymorphisms in TCEAL7 and risk of epithelial ovarian cancer.
18806825 2008 A role for candidate tumor-suppressor gene TCEAL7 in the regulation of c-Myc activity, cyclin D1 levels and cellular transformation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15870691 2005 Epigenetic silencing of TCEAL7 (Bex4) in ovarian cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.