Property Summary

NCBI Gene PubMed Count 20
PubMed Score 20.06
PubTator Score 18.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.867 2.7e-04
atypical teratoid / rhabdoid tumor -1.200 1.1e-06
glioblastoma -1.100 1.6e-04
medulloblastoma -1.100 6.9e-05
medulloblastoma, large-cell -1.700 1.8e-04
non-small cell lung cancer -1.003 3.5e-23
ovarian cancer -1.600 6.8e-10

Gene RIF (10)

PMID Text
19475409 Treatment with active matabolite of vitamin D (1alpha,25-dihydroxyvitamin D3) up-regulates mRNA expression of p21.
18640142 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16697770 Observational study of gene-disease association. (HuGE Navigator)
16542834 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16364249 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16331344 Observational study of gene-disease association. (HuGE Navigator)
16054204 Observational study of gene-disease association. (HuGE Navigator)
15807891 Observational study of gene-disease association. (HuGE Navigator)
15773840 There was a marked decrease in the levels of the transcriptional elongation factor A gene in squamous cell cancer compared to normal samples. Reduced expression of the TCEAL1 gene may be important in esophageal squamous cell carcinogenesis.
11248419 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDKPRKENEEEPQSRPRPMRRGLRWSTLPKSSPPRSSLRRSSPRRRSSFLRSSCLSSCLRCSSRRTPSAG      1 - 70
LSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRN     71 - 140
KLMIMHWKAKRSRPYPI                                                         141 - 157
//

Text Mined References (22)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19475409 2010 Treatment of K562 cells with 1,25-dihydroxyvitamin D3 induces distinct alterations in the expression of apoptosis-related genes BCL2, BAX, BCLXL, and p21.
18640142 2008 Polymorphisms in cell cycle regulatory genes, urinary arsenic profile and urothelial carcinoma.
16697770 2006 Polymorphisms of p53 and p21 genes in chronic obstructive pulmonary disease.
16542834 2006 Linking TP53 codon 72 and P21 nt590 genotypes to the development of cervical and ovarian cancer.
16364249 2006 TP53 and P21 polymorphisms: response to cisplatinum/paclitaxel-based chemotherapy in ovarian cancer.
16341674 2005 Transcriptome analysis of human gastric cancer.
16331344 2006 Association between TP53 and p21 genetic polymorphisms and acute side effects of radiotherapy in breast cancer patients.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
16054204 2005 Lack of evidence that proline homozygosity at codon 72 of p53 and rare arginine allele at codon 31 of p21, jointly mediate cervical cancer susceptibility among Indian women.
15807891 2005 A polymorphism at codon 31 of gene p21 is not associated with primary open angle glaucoma in Caucasians.
15773840 2005 Differential expression of TCEAL1 in esophageal cancers by custom cDNA microarray analysis.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11248419 2001 Polymorphisms in codon 31 of p21 and cervical cancer susceptibility in Korean women.
10353443 1999 The DNA-binding subunit p140 of replication factor C is upregulated in cycling cells and associates with G1 phase cell cycle regulatory proteins.
10051408 1999 Genomic structure and chromosomal localization of TCEAL1, a human gene encoding the nuclear phosphoprotein p21/SIIR.
8206389 1994 A HeLa-cell-encoded p21 is homologous to transcription elongation factor SII.
7971997 1994 Down-regulation of Rous sarcoma virus long terminal repeat promoter activity by a HeLa cell basic protein.
7592688 1995 The Ser36-Ser37 pair in HeLa nuclear protein p21/SIIR mediates Ser/Thr phosphorylation and is essential for Rous sarcoma virus long terminal repeat repression.