Property Summary

NCBI Gene PubMed Count 38
PubMed Score 394.01
PubTator Score 251.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 2.9e-04
Multiple myeloma 1327 5.8e-03
Waldenstrons macroglobulinemia 764 2.8e-02
Disease Target Count Z-score Confidence
Cockayne syndrome 54 4.405 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.268 2.8e-02
Multiple myeloma 1.235 5.8e-03
ovarian cancer 2.400 2.9e-04

Gene RIF (10)

PMID Text
21596312 RNF20, presumably via H2Bub, selectively represses oncogenic genes by interfering with chromatin recruitment of TFIIS, a factor capable of relieving stalled RNA polymerase II. RNF20 inhibits the interaction between TFIIS and the PAF1 complex.
21070792 Results indicate that TFIIS is not limiting for the repair of transcription-blocking DNA lesions and thus the present work does not support a role for TFIIS in TC-NER.
20729154 a role for TFIIS in transcription recovery and re-establishment of the balance between hypo- and hyper-phosphorylated RNAPII after DNA damage repair
16736500 PLAG1 protein is overexpressed in epithelial, myoepithelial, and mesenchymal-like tumor cells in tumors with fusions to CHCHD7 and TCEA1.
16630816 Data shpw that SII is a major component of chromatin transcription and strongly synergizes with p300 (histone acetylation) at a step subsequent to preinitiation complex formation.
15351637 TFIIS has a role in suppression of transient pausing, which is the most important contribution of TFIIS to elongation from a stall position
14506279 transcription factor IIF, hepatitis delta antigen, and stimulatory factor II control human RNA polymerase II (RNAP II) pausing and transcript cleavage
12914699 Results provide a model of the RNA polymerase II-transcription elongation factor TFIIS complex from X-ray diffraction data to 3.8 A resolution.
9765201 TFIIS synergizes with HIV-1 Tat during transactivation of the HIV-1 LTR promoter
1559613 TFIIS synergizes with HIV-1 Tat during transactivation of the HIV-1 LTR promoter

AA Sequence

MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLI      1 - 70
KSWKKLLDGPSTEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSV     71 - 140
RLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNV    141 - 210
LCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRS    211 - 280
ADEPMTTFVVCNECGNRWKFC                                                     281 - 301
//

Text Mined References (50)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21596312 2011 RNF20 inhibits TFIIS-facilitated transcriptional elongation to suppress pro-oncogenic gene expression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21127351 2011 Transcription factor IIS cooperates with the E3 ligase UBR5 to ubiquitinate the CDK9 subunit of the positive transcription elongation factor B.
21070792 2011 RNA interference against transcription elongation factor SII does not support its role in transcription-coupled nucleotide excision repair.
20729154 2010 Transcription factor IIS impacts UV-inhibited transcription.
20178742 2010 The human PAF1 complex acts in chromatin transcription elongation both independently and cooperatively with SII/TFIIS.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16736500 2006 CHCHD7-PLAG1 and TCEA1-PLAG1 gene fusions resulting from cryptic, intrachromosomal 8q rearrangements in pleomorphic salivary gland adenomas.
16648364 2006 A sequence motif conserved in diverse nuclear proteins identifies a protein interaction domain utilised for nuclear targeting by human TFIIS.
16630816 2006 Synergistic functions of SII and p300 in productive activator-dependent transcription of chromatin templates.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351637 2004 Transcription factors IIF and IIS and nucleoside triphosphate substrates as dynamic probes of the human RNA polymerase II mechanism.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14506279 2003 Combinatorial control of human RNA polymerase II (RNAP II) pausing and transcript cleavage by transcription factor IIF, hepatitis delta antigen, and stimulatory factor II.
12943681 2003 Identification of EloA-BP1, a novel Elongin A binding protein with an exonuclease homology domain.
12914699 2003 Architecture of the RNA polymerase II-TFIIS complex and implications for mRNA cleavage.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12761297 2003 Identification of a novel tissue-specific transcriptional activator FESTA as a protein that interacts with the transcription elongation factor S-II.
12676794 2003 The RNA polymerase II elongation complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
10029085 1999 Conserved mechanism of PLAG1 activation in salivary gland tumors with and without chromosome 8q12 abnormalities: identification of SII as a new fusion partner gene.
9765293 1998 FCP1, the RAP74-interacting subunit of a human protein phosphatase that dephosphorylates the carboxyl-terminal domain of RNA polymerase IIO.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9305922 1997 Interaction of elongation factors TFIIS and elongin A with a human RNA polymerase II holoenzyme capable of promoter-specific initiation and responsive to transcriptional activators.
8812434 1996 Transcription elongation factor SII (TCEA) maps to human chromosome 3p22 --> p21.3.
8798387 1996 Elongation factor SII contacts the 3'-end of RNA in the RNA polymerase II elongation complex.
8566795 1995 Isolation and characterization of a cDNA encoding a new type of human transcription elongation factor S-II.
8206389 1994 A HeLa-cell-encoded p21 is homologous to transcription elongation factor SII.
8112616 1994 Characterization of the gene encoding the human transcriptional elongation factor TFIIS.
7626141 1993 Structure of a new nucleic-acid-binding motif in eukaryotic transcriptional elongation factor TFIIS.
2471707 1989 Transcription elongation factor SII (TFIIS) enables RNA polymerase II to elongate through a block to transcription in a human gene in vitro.
1708494 1991 Cloning, expression and characterization of the human transcription elongation factor, TFIIS.
1559613 1992 HIV-1 Tat acts as a processivity factor in vitro in conjunction with cellular elongation factors.
1378807 1992 Characterization of a HeLa cDNA clone encoding the human SII protein, an elongation factor for RNA polymerase II.