Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.29
PubTator Score 3.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.532 1.6e-02
active ulcerative colitis 1.341 1.9e-02
acute myeloid leukemia -3.200 2.2e-02
ductal carcinoma in situ 1.100 3.7e-02
ependymoma 1.400 2.3e-05
group 4 medulloblastoma -1.100 2.0e-02
lung carcinoma -3.100 3.9e-29
osteosarcoma -2.192 1.2e-06
pancreatic ductal adenocarcinoma liver m... 1.311 1.7e-03
pituitary cancer -1.600 2.9e-03
psoriasis 1.100 1.6e-30

Gene RIF (2)

AA Sequence

MATEFIKSCCGGCFYGETEKHNFSVERDFKAAVPNSQNATISVPPLTSVSVKPQLGCTEDYLLSKLPSDG      1 - 70
KEVPFVVPKFKLSYIQPRTQETPSHLEELEGSARASFGDRKVELSSSSQHGPSYDVYNPFYMYQHISPDL     71 - 140
SRRFPPRSEVKRLYGSVCDLRTNKLPGSPGLSKSMFDLTNSSQRFIQRHDSLSSVPSSSSSRKNSQGSNR    141 - 210
SLDTITLSGDERDFGRLNVKLFYNSSVEQIWITVLQCRDLSWPSSYGDTPTVSIKGILTLPKPVHFKSSA    211 - 280
KEGSNAIEFMETFVFAIKLQNLQTVRLVFKIQTQTPRKKTIGECSMSLRTLSTQEMDYSLDITPPSKISV    281 - 350
CHAELELGTCFQAVNSRIQLQILEARYLPSSSTPLTLSFFVKVGMFSSGELIYKKKTRLLKASNGRVKWG    351 - 420
ETMIFPLIQSEKEIVFLIKLYSRSSVRRKHFVGQIWISEDSNNIEAVNQWKETVINPEKVVIRWHKLNPS    421 - 490
//

Text Mined References (14)

PMID Year Title