Property Summary

NCBI Gene PubMed Count 74
PubMed Score 1228.86
PubTator Score 91.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.560 5.0e-03
tuberculosis 1.900 3.6e-07
non-small cell lung cancer -1.035 9.0e-11
lung cancer -1.200 1.8e-02
active ulcerative colitis 1.528 7.3e-03
interstitial cystitis 1.300 2.2e-04
pilocytic astrocytoma 1.200 3.0e-07
subependymal giant cell astrocytoma 1.547 2.1e-02
lung carcinoma -2.000 5.4e-26
gastric carcinoma 1.100 3.4e-02

Protein-protein Interaction (1)

Gene RIF (41)

PMID Text
26974824 the administration of salted drinking water (2.7% NaCl) to wild-type mice resulted in elevated placental TXA2 synthase (TXAS) and plasma thromboxane A2, but not prostacyclin, levels, which was also found in clinical preeclampsia placenta samples.
26252103 Single nucleotide polymorphisms of TBXAS1 are associated with susceptibility to gout in ethnic Han males population.
26117917 The cardiovascular events significantly morefrequently occurred during 12 and 18 months in resistant diabetics and in the patients with an allele lacking the *2/*3 CYP2C9 gene function and AT/TT polymorphism of the thromboxane synthase gene TBS1.
26027242 The carriage of Thromboxane A synthase 1 gene polymorphism AA was shown to affect the risk of clopidogrel resistance.
24556579 study suggests that the anti-tumor effect of glycyrrhizin in lung adenocarcinoma is, at least in part, TxAS-dependent.
24009185 12-HHT is produced by both TxAS-dependent and TxAS-independent pathways in vitro and in vi
23763970 In this study we have showed, for the first time, a significant role of the minor allele rs6962291 of TBXAS1 in patients with NSAID acute cutaneous hypersensitivity.
22735388 The increased Km and decreased Vmax values observed with L357V suggest that this variant may generate less TXA2 at the low levels of PGH2 expected in vivo, raising the possibility of attenuated signaling through the thromboxane pathway.
22493072 Data show that that DNA methylation of the TBXAS1 promoter was decreased and thromboxane synthase expression was increased in omental arteries of preeclamptic women as compared with normal pregnant women.
22293189 these results showed that visfatin promoted IL-8 production by upregulation of TXAS, leading to angiogenic activation in endothelial cells.
21449675 The rare allele of rs6962291 may play a protective role against aspirin hypersensitivity via a lower catalytic activity of the TBXAS1 gene, attributed to the increase of a nonfunctioning isoform of TBXAS1.
21388528 Data suggest that targeting thromboxane synthase alone, or in combination with conventional chemotherapy is a potential therapeutic strategy for NSCLC.
21215134 Rs10487667 polymorphism in the CYP5A1 gene might be a risk factor of myocardial infarction in the Uigur population in Xinjiang.
20931532 The TC genotype and T allele of thromboxane synthase are risk factors of myocardial infarction.
20931532 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20647010 Apoptosis induced in lung cancer cells by the thromboxane synthase inhibitor 1-benzylimidazole is associated with the over-production of ROS and the reduction of NF-kappaB.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20383787 In humans, TXAS was expressed in the atherosclerotic lesion, associated with increased inflammatory cells, in particular M2 polarized macrophages, and increased in atherosclerotic lesions of patients with recent symptoms of thrombotic events.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20227257 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19729601 Observational study of gene-disease association. (HuGE Navigator)
19403042 The results suggest specific TBXAS1 gene polymorphisms may be a useful marker for development of cerebral infarction, especially SAO type in Korean population.
19403042 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19276290 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19114962 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19046748 TBXAS1 genetic variation is associated with incident myocardial infarction.
19046748 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18264100 Thromboxane synthase mutations in an increased bone density disorder (Ghosal syndrome).
16357168 Overexpression of thromboxane synthase is associated with invasive bladder cancer
15870920 Significantly higher expression of thromboxane synthase is associated with metastasis in non-small cell lung cancer
15067173 Cox-2 and TBXAS may play an important role in pituitary tumor development and progression
12432933 structure and function of the gene and protein - review
11956185 Transcriptional control of the human thromboxane synthase gene in vivo and in vitro.
11782360 Gene transfer of thromboxane A(2) synthase and prostaglandin I(2) synthase antithetically altered tumor angiogenesis and tumor growth.

AA Sequence

MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMEL      1 - 70
RKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALM     71 - 140
SAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFV    141 - 210
KHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQ    211 - 280
MVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTL    281 - 350
SFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEV    351 - 420
LGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVK    421 - 490
LTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR                               491 - 533
//

Text Mined References (78)

PMID Year Title
26974824 2016 Lack of Thromboxane Synthase Prevents Hypertension and Fetal Growth Restriction after High Salt Treatment during Pregnancy.
26252103 2015 [Association of single nucleotide polymorphisms of cytochrome P450 gene with susceptibility to gout in ethnic Han males from coastal regions of Shandong province].
26117917 2015 [CLINICAL AND PHARMACOLOGICAL FACTORS INFLUENCING RESISTANCE TO CLOPIDOGREL IN PATIENTS WITH CARDIOVASCULAR DISEASES].
26027242 2015 [Positive effect of low-activity thromboxane A synthase gene on prognosis in coronary heart disease].
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24556579 2014 Glycyrrhizin suppresses lung adenocarcinoma cell growth through inhibition of thromboxane synthase.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086445 2013 Genome-wide association analysis with gray matter volume as a quantitative phenotype in first-episode treatment-naïve patients with schizophrenia.
24009185 2013 Thromboxane A synthase-independent production of 12-hydroxyheptadecatrienoic acid, a BLT2 ligand.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23763970 2013 Association of thromboxane A1 synthase (TBXAS1) gene polymorphism with acute urticaria induced by nonsteroidal anti-inflammatory drugs.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23007406 2012 Genome-wide association study identifies germline polymorphisms associated with relapse of childhood acute lymphoblastic leukemia.
22735388 2012 Functional analysis of human thromboxane synthase polymorphic variants.
22493072 2012 Reduced methylation of the thromboxane synthase gene is correlated with its increased vascular expression in preeclampsia.
22293189 2012 Upregulation of thromboxane synthase mediates visfatin-induced interleukin-8 expression and angiogenic activity in endothelial cells.
21449675 2011 Association analysis of thromboxane A synthase 1 gene polymorphisms with aspirin intolerance in asthmatic patients.
21388528 2011 Examination of thromboxane synthase as a prognostic factor and therapeutic target in non-small cell lung cancer.
21215134 2010 [Association of Rs10487667 genetic polymorphism of thromboxane synthase with myocardial infarction in Uigur population of Xinjiang].
20931532 2010 [Association of the Pro1770Leu polymorphism in CYP5A1 gene with myocardial infarction in Uigur population of Xinjiang].
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20647010 2010 Thromboxane synthase suppression induces lung cancer cell apoptosis via inhibiting NF-?B.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20383787 2010 Thromboxane synthase expression and thromboxane A2 production in the atherosclerotic lesion.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20227257 2011 Polymorphisms in the platelet-specific collagen receptor GP6 are associated with risk of nonfatal myocardial infarction in Caucasians.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19403042 2009 Association of polymorphisms in thromboxane A2 receptor and thromboxane A synthase 1 with cerebral infarction in a Korean population.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19276290 2009 Common polymorphisms in the prostaglandin pathway genes and their association with breast cancer susceptibility and survival.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19114962 2009 The effect of an exon 12 polymorphism of the human thromboxane synthase (CYP5A1) gene in stroke patients.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19046748 2009 Variation in eicosanoid genes, non-fatal myocardial infarction and ischemic stroke.
18264100 2008 Thromboxane synthase mutations in an increased bone density disorder (Ghosal syndrome).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16357168 2005 Prognostic and functional significance of thromboxane synthase gene overexpression in invasive bladder cancer.
15870920 2005 Characterization of the prostaglandin biosynthetic pathway in non-small cell lung cancer: a comparison with small cell lung cancer and correlation with angiogenesis, angiogenic factors and metastases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15067173 2004 Analysis of Cox-2 and thromboxane synthase expression in pituitary adenomas and carcinomas.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14565864 2003 Nrf2 regulates thromboxane synthase gene expression in human lung cells.
12853948 2003 The DNA sequence of human chromosome 7.
12721789 2003 Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432933 2002 Thromboxane synthase: structure and function of protein and gene.
11782360 2002 Gene transfer of thromboxane A(2) synthase and prostaglandin I(2) synthase antithetically altered tumor angiogenesis and tumor growth.
11465543 2001 Identification of genetic variants in the human thromboxane synthase gene (CYP5A1).
11418589 2001 Coupling between cyclooxygenase, terminal prostanoid synthase, and phospholipase A2.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11297515 2001 Substrate binding is the rate-limiting step in thromboxane synthase catalysis.
10391210 1999 Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
9890157 1998 Molecular genetics of the human cytochrome P450 monooxygenase superfamily.
9847074 1998 Toward a complete human genome sequence.
9678486 1998 Thromboxanes: synthase and receptors.
8964509 1996 Genomic structure and polymorphism of the human thromboxane synthase-encoding gene.
8900410 1996 Characterization of the complete genomic structure of human thromboxane synthase gene and functional analysis of its promoter.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8366093 1993 Amino-terminal topology of thromboxane synthase in the endoplasmic reticulum.
8325653 1993 Mapping of the human thromboxane synthase gene (TBXAS1) to chromosome 7q34-q35 by two-color fluorescence in situ hybridization.
8198598 1994 Cloning and characterization of the human thromboxane synthase gene promoter.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7986068 1994 Alternate splicing of human thromboxane synthase mRNA.
7925341 1994 Characterization of the human gene (TBXAS1) encoding thromboxane synthase.
6101498 1980 Severe bleeding associated with defective thromboxane synthetase.
2195994 1990 Immunoaffinity purification of human thromboxane synthase.
2043115 1991 Isolation of partial complementary DNA encoding human thromboxane synthase.
1930241 1991 Thromboxane A2 synthesis in human erythroleukemia cells.
1730669 1992 Primary structure of human thromboxane synthase determined from the cDNA sequence.
1714723 1991 Molecular cloning of human platelet thromboxane A synthase.