Property Summary

NCBI Gene PubMed Count 120
PubMed Score 118.20
PubTator Score 273.71

Knowledge Summary

Patent (5,832)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.600 5.3e-05
osteosarcoma -2.258 5.3e-07
glioblastoma 1.700 9.8e-07
atypical teratoid / rhabdoid tumor -1.200 1.0e-04
pediatric high grade glioma 1.500 8.9e-08
pilocytic astrocytoma 1.400 1.3e-07
spina bifida 1.048 4.6e-02

Gene RIF (99)

PMID Text
26724804 Data suggest that thromboxane A2/TBXA2R signaling promotes multiple myeloma cell proliferation by reducing delay at G2/M phase via up-regulation of MAP kinase pathway, up-regulation of cyclin B1/CDK1 expression, and down-regulation of apoptosis.
25557379 The results of this study show that TXA2R polymorphisms may affect platelet function and the risk of developing cerebral ischemia.
25202904 Which could be attenuated by treatment with a TP antagonist (PTXA2).
24996187 TXA2 receptor associated with lipid rafts in platelets is important for functional platelet responses to TXA2
24490858 Data suggest TBXA2R requires Ser324 for normal activity; Ser324A mutant is insensitive to activation by protein kinase A/cell hypoxia, has high affinity for agonists (thromboxane A2/analogs), and participates in agonist-induced calcium mobilization.
24384873 TXA2 should be regarded as a critical molecule in COX-2-mediated tumor growth and a valuable target against lung cancer.
23840660 Human thromboxane A2 receptor genetic variant V80E exhibited reduced platelet activation whereas A160T demonstrated platelet hyperactivity.
23555978 Non-conservative substitution of E3.49 and E6.30 in prostanoid TP receptor results in superactive mutants that are more efficient in G protein coupling and activation.
23517037 Genetic variants were identified in the TBXA2R gene that influenced transcriptional activity and were associated with asthma-related phenotypes.
23493750 Targeting the TPalpha-TM5 GxxxGxxxL domain may allow development of biased TPalpha homodimer antagonists that avoid suppression of IP-TPalpha heterodimer function.
23456445 There was no significant association between rs4523 variants and CI. However, there was a significant difference in the overall distribution of genotypes and dominant/recessive models of rs768963 between CI and control groups
23349788 Data show that TXA(2) mimetic, I-BOP, induced monocyte chemoattractant protein -1(MCP-1)/chemokine (C-C motif) ligand 2 (CCL2) expression at both mRNA and protein levels in lung adenocarcinoma A549 cells.
23279270 In the very rare disorder TP receptor deficiency the W29C substitution reduces TP receptor function by reducing surface receptor expression and by disrupting ligand binding.
23255603 The results indicate that the beta1-subunit can form a tripartite complex with TP and MaxiKalpha, has the ability to associate with each protein independently.
23162015 IP receptor heteridimerization with thromboxane receptor facilitates receptor trafficking to membrane lipid rafts.
23107873 These results do not support that thromboxane prostanoid receptor activation could exert a moderating influence on reactive hyperemia in human skin and skeletal muscle, at least in young subjects
22272267 Data show that that Ala160(4.53) and Gly164(4.57) in the thromboxane A2 receptor (TP)play critical structural roles in packing of TM3 and TM4 helices.
22101342 The frequencies of the CC/CT genotype of TBXA2R +795T>C were higher than those of the TT genotype in AERD patients compared to aspirin-tolerant asthma patients.
22017802 STAT6 and TBXA2R polymorphisms were not associated with asthma risk, but they were associated with asthma-related symptoms.
22008592 The carboxyl-terminal segment of thromboxane A2 receptor second extracellular loop plays a critical role in platelet activation.
21740787 TBXA2R-924T allele was involved in AR. Diabetes was an independent risk factor of aspirin resistance.
21734400 Studies indicate that RAD50 and PTPRE of crude associations with asthma at a Bonferroni-corrected level of significance, while IL4R, CCL5 and TBXA2R of nominal significance.
21491143 HIV-1 clade B gp120 induces higher levels of expression of the neuropathogenic molecule cyclooxygenase-2 (COX-2)-mediated arachidonic acid by-products, prostaglandin E2 (PGE2) and thromboxane A2 receptor (TBXA2R) compared to clade C gp120
21357687 PRK1 as a bona fide interactant of TPalpha/TPbeta, and leading to H3 Thr(11) phosphorylation to regulate cell migration
21342433 the impaired platelet activation in response to U46619 in the heterozygous subject for the TXA(2)R mutation is, at least in part, as a result of the decrease in ADP secretion
21172430 angio-associated migratory cell protein was identified as a novel interacting partner of both TPalpha and TPbeta isoforms of the thromboxane A2 receptor
21070398 The results suggest that the TBXA2R-4684T allele may be associated with lower TBXA2R expression, which may contribute to the development of the aspirin-intolerant acute urticaria phenotype.
21070398 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20959415 vasoconstrictor TP receptor and MaxiK-channel direct interaction facilitates G-protein-independent TP to MaxiK trans-inhibition, which would promote vasoconstriction.
20856817 TBXA2R signaling was regulated by oxidative stress-induced stabilization and relocation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20590159 possibility of ligand-free constitutive TBXA2R signaling through Galphaq binding
20522022 A unique megakaryocytic cell line UT-7/TPO could respond to one of the primary platelet signals through GP (glycoprotein) VI and a secondary signal of the AA (arachidonic acid) cascade.
20395963 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19853959 mediates tumor growth and angiogenesis in human lung cancer cells
19828703 D304N substitution causes clinically significant platelet dysfunction by reducing ligand binding establishes the importance of the NPXXY motif for TxA(2)R function in vivo
19772916 TXA(2) receptor mediates water influx through aquaporins in astrocytoma cells via TXA(2) receptor-mediated activation of G alpha(12/13), Rho A, Rho kinase and Na(+)/H(+)-exchanger.
19747485 Regulated WT1 followed by sequential Egr1 and Sp1 binding to elements within Prm1 mediate repression and subsequent induction of TPalpha during differentiation into the megakaryocytic phenotype.
19570744 Activation of thromboxane A(2) receptors induces orphan nuclear receptor Nurr1 expression and stimulates cell proliferation in human lung cancer cells.
19403525 Thromboxane A2 receptor stimulation impairs insulin signaling in vascular endothelial cells by selectively activating the Rho/Rho-associated kinase/LKB1/PTEN pathway.
19403042 Data examined and excluded TBXA2R are risk factors for cerebral infarction by genotyping 453 Korean patients with noncardiogenic cerebral infarction and 260 controls.
19403042 Observational study of gene-disease association. (HuGE Navigator)
19264973 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19170518 the structural flexibility of the purified human thromboxane A2 receptor was characterized by spectroscopic approaches, while bound to an agonist or antagonist
19086263 LDL concentration and degree of oxidation synergistically stimulate NO and IL-6 production, but only NO release is largely mediated by the TP receptor. LDL facilitates ET-1 release independent of concentration and degree of oxidation
19067769 These data establish WT1 as a critical repressor of thromboxane A2 receptor promoter Prm1, suppressing TPalpha expression.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18950617 activation of prostanoid thromboxane A(2) receptors in a Th2-dominant microenvironment might exacerbate the eosinophilic inflammation of the airways by synthesis and release of CCL11 from bronchial smooth muscle cells
18802021 Demonstrate that isoprostanes inhibit angiogenesis via activation of the TBXA2R.
18698092 Regulation of the human thromboxane A2 receptor gene by Sp1, Egr1, NF-E2, GATA-1, and Ets-1 in megakaryocytes.
18647220 endocannabinoid 2-arachidonoylglycerol induced platelet activation with a dose-dependent mechanism that required engagement of platelet TxA(2) receptors
18573679 Data suggest that expression of prostanoid receptors (prostaglandin E2 EP3-I, prostacyclin, and thromboxane A2 receptors) in vascular inflammation could influence cell responses dependent on the constitutive activation of ghrelin receptors.
18529068 studies provide a basis for the high-yield expression and purification of the G protein-coupled receptor for the structural and functional characterization using biophysics approaches
18502100 New roles for TPalpha and TPbeta and, through studies in aortic smooth muscle cells, reveal an additional mode of regulation of vascular smooth muscle contractile responses by TXA(2).
18172303 TBXA2R are expressed in prostate cancer and activation of TBXA2R regulates prostate cancer cell motility and cytoskeleton reorganization through activation of RhoA.
18088343 analysis of regulation of platelet responses to P2Y and thromboxane receptor activation
18088317 RACK1 directly binds to the C-terminus and the first intracellular loop of the beta isoform of the thromboxane A(2) receptor
18073117 These results reveal the possibly important molecular mechanisms in TP signaling and provide structural information to characterize other prostanoid receptor signalings.
18063812 TPr stimulation triggers reactive oxygen species-mediated LKB1-dependent AMPK activation, which in return inhibits cellular protein synthesis in VSMCs.
18031559 Observational study of gene-disease association. (HuGE Navigator)
18005048 Expression of prostaglandin E(2) receptors (EP(2), EP(3), EP(4)), prostaglandin D(2) receptor (DP(2)), prostanoid thromboxane A(2) receptor (TP) and to a lesser extent EP(1) were observed in several hair follicle compartments.
17924829 Observational study of gene-gene interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17644091 PRDX4 interacts with and regulates TBXA2R.
17499743 Results suggest that TP beta binds to alpha 7 and PA28 gamma, and the cell-surface expression of TP beta is lower than that of TP alpha.
17496729 Observational study of gene-disease association. (HuGE Navigator)
17249521 Observational study of gene-disease association. (HuGE Navigator)
17249521 Specific single nucleotide polymorphisms and haplotypes may have utility as genetic markers for the risk of cerebral infarction.
17229546 Studies confirm that TPbeta isoform but not TPalpha is palmitoylated at Cys347, and to a lesser extent at Cys373/377 a modification that induces signalling and internalization.
17192347 Food intake increases this receptor's platelet activation in type 2 diabetes but not in normal controls.
16953279 analysis of functional polymorphisms of the thromboxane A2 receptor
16837469 analysis of key amino acids (in particular Asp(193)) involved in TPR ligand coordination
16212421 analysis of the molecular mechanism of how the human TXA2 receptor interacts with G alpha 13 to activate intracellular signaling
16156795 data provide direct evidence for the role of PPARgamma in the regulation of human TBXA2R gene expression within the vasculature and point to further critical differences in the modes of transcriptional regulation of TBXA2R alpha and TBXA2R beta in humans
16126723 an interaction between Rab11 and TPbeta directs TPbeta recycling
15898979 Observational study of gene-disease association. (HuGE Navigator)
15845539 the actin cytoskeleton plays an essential role in TPbeta endocytosis
15805995 Observational study of gene-disease association. (HuGE Navigator)
15519496 Thromboxane A2 receptor receptor activation causes DNA synthesis and cell proliferation of human bronchial smooth muscle cell
15471868 prostacyclin and thromboxane receptor dimerization facilitates thromboxane receptor-mediated cAMP generation
15354262 important physiological activators of platelets and exert their effects by acting on cell surface receptors
15242977 TPbeta, but not TPalpha, expression is required for the inhibition of VEGF-induced migration and angiogenesis. TP stimulation appears to limit angiogenesis, at least in part, by inhibiting the pro-angiogenic cytokine VEGF.
15233797 Results describe a three-dimensional structural model for the thromboxane A(2) receptor.
15134434 Constitutive endocytosis of thromboxane A2 receptor forms a pool of receptors in the perinuclear recycling endosome from which they recycle to the cell surface, a process involved in preserving receptor sensitivity to agonist stimulation.
14976202 Nm23-H2 had a cytoplasmic and nuclear localization but was induced to translocate to the plasma membrane upon stimulation of thromboxane A2 receptor beta to show extensive co-localization with the receptor.
14963009 A novel role is shown for isoform-specific regulation of angiogenesis by TBXA2R, providing the 1st functional significance for the existence of 2 TP isoforms in humans, & clarifying the mechanism by which TP signaling regulates FGFR1 kinetics & signaling.
14602550 TXA2 receptors mediated concurrent platelet aggregation and shape change responses, that are differentially modulated by different signaling pathways
14583632 results indicate that oxidative stress induces maturation and stabilization of the thromboxane A(2)Receptor beta protein probably by intracellular translocation
14580363 These experiments indicate that the expression of the human thromboxane A2 receptor is differently regulated in platelet precursor cells by the protein kinase A and C pathway.
12796499 Thromboxane A2 (TXA2)-mediated platelet secretion and aggregation are important in thrombosis and the stable TXA2 analogue, U46619, induces two waves of platelet secretion, each of which precedes a distinct wave of platelet aggregation
12781781 analysis of third extracellular loop of human thromboxane A2 receptor
12213432 Transcriptional activity of the 5'flanking region
12180983 The role of TXA2R 5' UTR in differential isoform expression was studied. Exons E1 & E1b associated with TXA2R transcript(s), but their expression was mutually exclusive. Major transcription initiation sites were between -115 & -92 in E1 & at -99 in E1b.
12000493 Observational study of gene-disease association. (HuGE Navigator)
11922633 Observational study of gene-disease association. (HuGE Navigator)
11922633 These results suggest TXA2 receptor polymorphism strongly interacts with IL-4R alpha polymorphism as a major determinant of high serum immunoglobulin E levels in atopic dermatitis.
11877412 Mapping of a ligand-binding site for the human thromboxane A2 receptor protein.
11848439 Prostaglandin endoperoxides and thromboxane A2 activate the same receptor isoforms in human platelets.

AA Sequence

MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGL      1 - 70
VLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSR     71 - 140
PAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGL    141 - 210
SFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAG    211 - 280
QLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ           281 - 343
//

Text Mined References (122)

PMID Year Title
26724804 2016 Thromboxane A2 Receptor Inhibition Suppresses Multiple Myeloma Cell Proliferation by Inducing p38/c-Jun N-terminal Kinase (JNK) Mitogen-activated Protein Kinase (MAPK)-mediated G2/M Progression Delay and Cell Apoptosis.
25557379 2015 Thromboxane A2 receptor polymorphism in association with cerebral infarction and its regulation on platelet function.
25202904 2014 Regulation of the tumor suppressor FOXO3 by the thromboxane-A2 receptors in urothelial cancer.
24996187 2014 The association of thromboxane A2 receptor with lipid rafts is a determinant for platelet functional responses.
24490858 2014 Thromboxane receptor hyper-responsiveness in hypoxic pulmonary hypertension requires serine 324.
24384873 2014 Thromboxane A2 exerts promoting effects on cell proliferation through mediating cyclooxygenase-2 signal in lung adenocarcinoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23840660 2013 Human thromboxane A2 receptor genetic variants: in silico, in vitro and "in platelet" analysis.
23555978 2013 Full and partial agonists of thromboxane prostanoid receptor unveil fine tuning of receptor superactive conformation and G protein activation.
23517037 2013 Functional variants in the thromboxane A2 receptor gene are associated with lung function in childhood-onset asthma.
23493750 2013 Biased suppression of TP homodimerization and signaling through disruption of a TM GxxxGxxxL helical interaction motif.
23456445 2013 Association of thromboxane A2 receptor gene polymorphisms with cerebral infarction in a Chinese population.
23349788 2013 Activation of thromboxane A2 receptor (TP) increases the expression of monocyte chemoattractant protein -1 (MCP-1)/chemokine (C-C motif) ligand 2 (CCL2) and recruits macrophages to promote invasion of lung cancer cells.
23279270 2013 Platelet dysfunction associated with the novel Trp29Cys thromboxane A? receptor variant.
23255603 2013 The ?1-subunit of the MaxiK channel associates with the thromboxane A2 receptor and reduces thromboxane A2 functional effects.
23162015 2013 Heterodimerization with the prostacyclin receptor triggers thromboxane receptor relocation to lipid rafts.
23107873 2013 No implication of thromboxane prostanoid receptors in reactive hyperemia of skin and skeletal muscle in human forearm.
22272267 2012 Site-directed mutations and the polymorphic variant Ala160Thr in the human thromboxane receptor uncover a structural role for transmembrane helix 4.
22101342 2012 Thromboxane A2 receptor +795T>C and chemoattractant receptor-homologous molecule expressed on Th2 cells -466T>C gene polymorphisms in patients with aspirin-exacerbated respiratory disease.
22017802 2012 Association of ORMDL3, STAT6 and TBXA2R gene polymorphisms with asthma.
22008592 2012 The C-terminal segment of the second extracellular loop of the thromboxane A2 receptor plays an important role in platelet aggregation.
21740787 2011 Effect of polymorphism and type II diabetes on aspirin resistance in patients with unstable coronary artery disease.
21734400 2011 Attempted replication of 50 reported asthma risk genes identifies a SNP in RAD50 as associated with childhood atopic asthma.
21357687 2011 Identification of an interaction between the TPalpha and TPbeta isoforms of the human thromboxane A2 receptor with protein kinase C-related kinase (PRK) 1: implications for prostate cancer.
21342433 2011 Bleeding tendency and impaired platelet function in a patient carrying a heterozygous mutation in the thromboxane A2 receptor.
21172430 2011 Interaction of angio-associated migratory cell protein with the TP? and TP? isoforms of the human thromboxane A? receptor.
21070398 2011 Association of thromboxane A2 receptor (TBXA2R) gene polymorphism in patients with aspirin-intolerant acute urticaria.
20959415 2010 Thromboxane A2 receptor and MaxiK-channel intimate interaction supports channel trans-inhibition independent of G-protein activation.
20856817 2010 Regulation of thromboxane receptor signaling at multiple levels by oxidative stress-induced stabilization, relocation and enhanced responsiveness.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20590159 2010 Structural and functional analysis of the C-terminus of Galphaq in complex with the human thromboxane A2 receptor provides evidence of constitutive activity.
20522022 2010 The human megakaryocytic cell line UT-7/TPO expresses functional platelet agonist signals mediated through GPVI and thromboxane receptor.
20395963 2010 Replication of genetic association studies in asthma and related phenotypes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19853959 2010 Thromboxane receptor alpha mediates tumor growth and angiogenesis via induction of vascular endothelial growth factor expression in human lung cancer cells.
19828703 2010 A novel thromboxane A2 receptor D304N variant that abrogates ligand binding in a patient with a bleeding diathesis.
19772916 2010 Involvement of aquaporin in thromboxane A2 receptor-mediated, G 12/13/RhoA/NHE-sensitive cell swelling in 1321N1 human astrocytoma cells.
19747485 2009 Regulated expression of the alpha isoform of the human thromboxane A2 receptor during megakaryocyte differentiation: a coordinated role for WT1, Egr1, and Sp1.
19570744 2009 Activation of thromboxane A(2) receptors induces orphan nuclear receptor Nurr1 expression and stimulates cell proliferation in human lung cancer cells.
19464661 2009 Thromboxane A2-induced signal transduction is negatively regulated by KIAA1005 that directly interacts with thromboxane A2 receptor.
19403525 2009 Thromboxane A2 receptor activates a Rho-associated kinase/LKB1/PTEN pathway to attenuate endothelium insulin signaling.
19403042 2009 Association of polymorphisms in thromboxane A2 receptor and thromboxane A synthase 1 with cerebral infarction in a Korean population.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19170518 2009 Ligand-specific conformation determines agonist activation and antagonist blockade in purified human thromboxane A2 receptor.
19086263 2008 Role of thromboxane A2 receptor on the effects of oxidized LDL on microvascular endothelium nitric oxide, endothelin-1, and IL-6 production.
19067769 The Wilms' tumour suppressor protein WT1 acts as a key transcriptional repressor of the human thromboxane A2 receptor gene in megakaryocytes.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18950617 2008 TP receptor-mediated release of eosinophil chemotactic activity from human bronchial smooth muscle cells.
18802021 2008 Isoprostanes inhibit vascular endothelial growth factor-induced endothelial cell migration, tube formation, and cardiac vessel sprouting in vitro, as well as angiogenesis in vivo via activation of the thromboxane A(2) receptor: a potential link between oxidative stress and impaired angiogenesis.
18698092 2008 Regulation of the human thromboxane A2 receptor gene by Sp1, Egr1, NF-E2, GATA-1, and Ets-1 in megakaryocytes.
18647220 2008 The endocannabinoid 2-arachidonoylglycerol activates human platelets through non-CB1/CB2 receptors.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18573679 2008 The constitutive activity of ghrelin receptors is decreased by co-expression with vasoactive prostanoid receptors when over-expressed in human embryonic kidney 293 cells.
18529068 2008 A simple, quick, and high-yield preparation of the human thromboxane A2 receptor in full size for structural studies.
18502100 2008 Differential regulation of RhoA-mediated signaling by the TPalpha and TPbeta isoforms of the human thromboxane A2 receptor: independent modulation of TPalpha signaling by prostacyclin and nitric oxide.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18172303 2008 Thromboxane A2 receptors in prostate carcinoma: expression and its role in regulating cell motility via small GTPase Rho.
18088343 2008 Reciprocal regulation of platelet responses to P2Y and thromboxane receptor activation.
18088317 2008 RACK1 regulates the cell surface expression of the G protein-coupled receptor for thromboxane A(2).
18073117 2008 Assembling NMR structures for the intracellular loops of the human thromboxane A2 receptor: implication of the G protein-coupling pocket.
18063812 2008 Thromboxane receptor activates the AMP-activated protein kinase in vascular smooth muscle cells via hydrogen peroxide.
18031559 2008 TBXA2R gene polymorphism and responsiveness to leukotriene receptor antagonist in children with asthma.
18005048 2008 Prostanoid receptors in anagen human hair follicles.
17924829 2007 CysLTR1 promoter polymorphism and requirement for leukotriene receptor antagonist in aspirin-intolerant asthma patients.
17644091 2007 Peroxiredoxin-4 interacts with and regulates the thromboxane A(2) receptor.
17499743 2007 Low expression of cell-surface thromboxane A2 receptor beta-isoform through the negative regulation of its membrane traffic by proteasomes.
17496729 2007 Association between polymorphisms in prostanoid receptor genes and aspirin-intolerant asthma.
17249521 2006 Relationship between the thromboxane A2 receptor gene and susceptibility to cerebral infarction.
17229546 2007 Palmitoylation of the TPbeta isoform of the human thromboxane A2 receptor. Modulation of G protein: effector coupling and modes of receptor internalization.
17192347 2007 Food intake enhances thromboxane receptor-mediated platelet activation in type 2 diabetic patients but not in healthy subjects.
16953279 2006 Identification of functional polymorphisms of the thromboxane A2 receptor gene in healthy volunteers.
16837469 2006 Differential mapping of the amino acids mediating agonist and antagonist coordination with the human thromboxane A2 receptor protein.
16418336 2006 The G12 family of G proteins as a reporter of thromboxane A2 receptor activity.
16413928 2006 14-3-3zeta interacts with human thromboxane receptors and is involved in the agonist-induced activation of the extracellular-signal-regulated kinase.
16212421 Coupling interaction between thromboxane A2 receptor and alpha-13 subunit of guanine nucleotide-binding protein.
16156795 2005 15-deoxy Delta12,14-prostaglandin J2 suppresses transcription by promoter 3 of the human thromboxane A2 receptor gene through peroxisome proliferator-activated receptor gamma in human erythroleukemia cells.
16126723 2005 The intracellular trafficking of the G protein-coupled receptor TPbeta depends on a direct interaction with Rab11.
15898979 2005 Association of thromboxane A2 receptor gene polymorphism with the phenotype of acetyl salicylic acid-intolerant asthma.
15845539 2005 Involvement of actin in agonist-induced endocytosis of the G protein-coupled receptor for thromboxane A2: overcoming of actin disruption by arrestin-3 but not arrestin-2.
15805995 2005 IL-5 and thromboxane A2 receptor gene polymorphisms are associated with decreased pulmonary function in Korean children with atopic asthma.
15519496 2004 Human bronchial smooth muscle cell proliferation via thromboxane A2 receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471868 2004 Dimerization of the human receptors for prostacyclin and thromboxane facilitates thromboxane receptor-mediated cAMP generation.
15354262 2004 Platelet receptors for adenine nucleotides and thromboxane A2.
15242977 2004 Thromboxane A2 receptor signaling inhibits vascular endothelial growth factor-induced endothelial cell differentiation and migration.
15233797 2004 NMR structure of the thromboxane A2 receptor ligand recognition pocket.
15134434 2004 Role of the Rab11-associated intracellular pool of receptors formed by constitutive endocytosis of the beta isoform of the thromboxane A2 receptor (TP beta).
15086532 2004 Identification of a novel family of G protein-coupled receptor associated sorting proteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14976202 2004 Nm23-H2 interacts with a G protein-coupled receptor to regulate its endocytosis through an Rac1-dependent mechanism.
14963009 2004 Thromboxane A2 receptor agonists antagonize the proangiogenic effects of fibroblast growth factor-2: role of receptor internalization, thrombospondin-1, and alpha(v)beta3.
14602550 2003 Diversity of signaling underlying responses mediated by selective activation of the platelet thromboxane A2 (TXA2) receptor; pharmacological and kinetic studies in vitro.
14583632 2004 The mechanism of oxidative stress stabilization of the thromboxane receptor in COS-7 cells.
14580363 2003 Regulation of the human thromboxane A2 receptor gene in human megakaryoblastic MEG-01 cells.
12796499 2003 Two waves of platelet secretion induced by thromboxane A2 receptor and a critical role for phosphoinositide 3-kinases.
12781781 2003 Solution structure of the third extracellular loop of human thromboxane A2 receptor.
12551898 2003 Identification of residues important for ligand binding of thromboxane A2 receptor in the second extracellular loop using the NMR experiment-guided mutagenesis approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213432 2002 The 5' region of the human thromboxane A(2) receptor gene.
12193606 2002 Regulation of GTP-binding protein alpha q (Galpha q) signaling by the ezrin-radixin-moesin-binding phosphoprotein-50 (EBP50).
12180983 2002 Characterization of the 5' untranslated region of alpha and beta isoforms of the human thromboxane A2 receptor (TP). Differential promoter utilization by the TP isoforms.
12000493 2002 Thromboxane A2 receptor gene polymorphism is associated with the serum concentration of cat-specific immunoglobulin E as well as the development and severity of asthma in Chinese children.
11922633 2002 Genetic variants of the receptors for thromboxane A2 and IL-4 in atopic dermatitis.
11848439 2002 Prostaglandin endoperoxides and thromboxane A2 activate the same receptor isoforms in human platelets.
11504827 2001 Phosphorylation and desensitization of the human thromboxane receptor-alpha by G protein-coupled receptor kinases.
10402514 1999 Genome scan for linkage to Gilles de la Tourette syndrome.
10395940 1999 Coupling of thromboxane A2 receptor isoforms to Galpha13: effects on ligand binding and signalling.
9152406 1997 The human thromboxane A2 receptor alpha isoform (TP alpha) functionally couples to the G proteins Gq and G11 in vivo and is activated by the isoprostane 8-epi prostaglandin F2 alpha.
8613548 1996 Two thromboxane A2 receptor isoforms in human platelets. Opposite coupling to adenylyl cyclase with different sensitivity to Arg60 to Leu mutation.
8433523 1993 [Thromboxane A2 receptor; structure, function and tissue distribution].
8290554 1994 G proteins of the G12 family are activated via thromboxane A2 and thrombin receptors in human platelets.
8288221 1993 Linkage mapping of the human thromboxane A2 receptor (TBXA2R) to chromosome 19p13.3 using transcribed 3' untranslated DNA sequence polymorphisms.
8246916 1993 Point mutation in the seventh hydrophobic domain of the human thromboxane A2 receptor allows discrimination between agonist and antagonist binding sites.
8227091 1993 Characterization and chromosomal mapping of the human thromboxane A2 receptor gene.
8119956 1994 Purification of rat brain, rabbit aorta, and human platelet thromboxane A2/prostaglandin H2 receptors by immunoaffinity chromatography employing anti-peptide and anti-receptor antibodies.
8034687 1994 Alternative splicing produces a divergent cytoplasmic tail in the human endothelial thromboxane A2 receptor.
7965765 1994 Cloning and pharmacologic characterization of a thromboxane A2 receptor from K562 (human chronic myelogenous leukemia) cells.
7929844 1994 Arg60 to Leu mutation of the human thromboxane A2 receptor in a dominantly inherited bleeding disorder.
7896853 1995 Alternative splicing produces a divergent cytoplasmic tail in the human endothelial thromboxane A2 receptor.
1825698 1991 Cloning and expression of cDNA for a human thromboxane A2 receptor.