Property Summary

NCBI Gene PubMed Count 111
PubMed Score 244.36
PubTator Score 167.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.200 1.2e-09
lung cancer -1.200 5.3e-04
lung carcinoma -1.700 3.8e-11
medulloblastoma, large-cell 1.100 3.5e-02
non-small cell lung cancer -1.651 1.1e-18

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (81)

AA Sequence

MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEV      1 - 70
GTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPD     71 - 140
SPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETA    141 - 210
FIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRA    211 - 280
LSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEE    281 - 350
DSFYRSSYPQQQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDR    351 - 420
LPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYS    421 - 490
HGVPRTLSPHQYHSVHGVGMVPEWSDNS                                              491 - 518
//

Text Mined References (113)

PMID Year Title