Property Summary

NCBI Gene PubMed Count 158
PubMed Score 767.66
PubTator Score 319.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 2.0e-03
osteosarcoma -1.502 8.5e-04
lung adenocarcinoma -1.200 1.8e-07
psoriasis 1.400 2.2e-26

Synonym

Accession Q9UL17 T-box protein 21
Symbols TBET
T-PET
T-bet
TBLYM

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (165)

PMID Text
27082299 A high copy number of T-bet and GATA-3 confers susceptibility to AAU and AS, and a high copy number of FOXP3 confers susceptibility to female patients with AAU either with or without AS.
26950239 There is a common program of effector T cell differentiation that is regulated by IL-2 and IL-12 signaling and the combined activities of the transcriptional regulators Blimp-1 and T-bet.
26809262 expression of T-bet may influence the function of HBV-specific CD8+ T cells and thus can be an attractive target for modulation to improve HBV-specific immunity in CHB.
26762769 TBX21 expression was low in multiple sclerosis (MS), and stable over time. The low EOMES/TBX21 phenotype in MS reflects cd56+ cell dysregulation.
26520896 HMGB1 contributed to IFN-gamma-producing Th17-cell bias in coronary artery atherosclerosis by controlling expression of T-bet and RUNX3.
26438526 the level of T-bet and Eomesodermin, two T-box transcription factors regulating lymphocyte effector functions, is strongly reduced in NK cells from allogeneic hematopoietic stem cell transplantation recipients compared with healthy control subjects.
26418311 Data indicate that overexpression of micrRNA miR-135a alters transcription factor T-bet and GATA binding protein 3 (GATA-3) mRNA expression in allergic rhinitis (AR).
26302932 T-bet expression might be associated with differentiation into effector memory cells and PD-1 expression in mycobacterial antigen-specific CD4(+) T cells.
26297793 Studies indicate that a key feature of age-associated B cells (ABCs) is that they express and depend upon B cell-intrinsic expression of the T-bet transcription factor.
26214042 Our data indicate that Tim-3 expression on NK cells is regulated by T-bet, and that Tim-3 levels correlate with advanced stages of gastric cancer
25873156 The tested 25 SNPs in TBX21, GATA3, Rorc and Foxp3 did not associate with BD and VKH syndrome.
25832120 observed the polymorphic allele T was enriched in the chronic periodontitis patients compared to chronic gingivitis patients; investigating the putative functionality TBX21-1993T/C in modulation of local response, observed transcript levels of T-bet, but not of IFN-gamma, were upregulated in homozygote and heterozygote polymorphic subjects
25759111 Our results suggested that TBX21 variants may be involved in the etiology of this disease.
25577251 Especially, the ACC, ACT, and ATC haplotypes derived from the TBX21 gene would increase the susceptibility to ESCC in the high-risk Chinese population.
25575062 Expression of T-bet was high in gammadeltaT cells that were expanded in the Th2 polarizing condition.
25552913 The mRNA level of Th1-specific transcription factor T-bet was reduced in patients with liver cancer.
25505279 Chronic lymphocytic leukemia cells express CD38 in response to Th1 cell-derived IFN-gamma by a T-bet-dependent mechanism.
25495780 Knockdown of T-bet expression in Mart-127-35 -specific T-cell-receptor-engineered human CD4(+) CD25(-) and CD8(+) T cells attenuates effector function.
25400774 High tumor nuclei T-bet expression in primary tumors of breast cancer was correlated with poor prognosis and high density of T-bet+ interstitial lymphocytes in primary tumors of breast cancer were correlated with favorable prognosis.
25378399 Results indicate that the pre-existence and nuclear mobilization of transcription factor T-bet in resting memory CD4(+) T cells might be a possible transcriptional mechanism for rapid production of cytokines by memory CD4(+) T cells.
25352127 TOX2 plays a crucial role in controlling normal NK cell development by acting upstream of TBX21 transcriptional regulation
25340608 The transcription factor, t-bet, primes intestinal transplant rejection, and associates with disrupted homeostatic relationships between innate and adaptive immune cells in the allograft mucosa during rejection.
25339676 expression in CD8+ T cells during early chronic infection differentiates controllers from relapsers
25292313 Data show that the expression levels of transcription factors GATA-3 and FOXP3 were upregulated with 1.0 mug/ml galectin-1, while transcription factors TBX21 and RORC expression levels were reduced with both 1.0 and 2.0 mug/ml concentrations of galectin-1.
25225458 Dysfunctional CD8+ T cells in hepatitis B and C are characterized by a lack of antigen-specific T-bet induction.
25056814 study concludes that TBX21 gene polymorphism was associated with an increased risk of asthma in Indian population
25032686 This study supports the concept that poor human viral-specific CD8(+) T cell functionality is due to an inverse expression balance between T-bet and Eomes
24901011 T-bet undergoes several post-translational protein modifications, such as phosphorylation and ubiquitination, which affect lineage commitment during T-cell differentiation. (Review)
24845384 this study identified USP10, a carboxyl-terminal ubiquitin-processing protease, could interact with T-bet in the nucleus.
24841128 HIV-1 Tat upregulates the expression of T-bet, Eomesdermin, Blimp-1, Bcl-6, and Bcl-2 in stimulated but not in unstimulated CD8+ T lymphocytes
24766459 Study shows the capacity of human CD4(+) and CD8(+) T cells for stable co-expression of GATA-3 and T-bet in humanized mice and reveals a critical role for IL-12 in regulating this phenotype.
24660543 Abnormal expression of the transcription factors T-bet and GATA-3 contributes to the imbalance of Thl/Th2 lymphocytes associated with immune dysfunction, leading to the development and progression of aplastic anemia.
24495857 The autoimmune disease-associated transcription factors EOMES and TBX21 are dysregulated in multiple sclerosis and define a molecular subtype of disease.
24338248 In the presence of 100 ng/ml IL-11, GATA-3 transcript abundance rose up to ~85-fold of that measured in untreated cells, whereas T-bet transcripts were lowered merely to ~41%
24262372 genetic polymorphism is associated with chronic immune thrombocytopenia in Chinese population
24235972 intraglomerular predominance of T-bet over GATA3 might be used as diagnosis maker of ABMR in addition to C4d, especially in C4d-negative cases.
24107858 Polymorphism rs9910408 in TBX21 gene was associated with response to inhaled corticosteroids in asthma.
23855758 IRTA1 and T-bet are positive markers for the diagnosis of nodal marginal zone lymphoma
23608226 EBV-encoded miR-BART20-5p inhibits T-bet translation with secondary suppression of p53 in invasive nasal NK/T-cell lymphoma.[
23607257 Marginal zone lymphomas with monocytoid morphology express T-bet and are associated with a low number of T cells in extranodal locations.
23479229 IL-21-induced cytotoxic T lymphocyte (CTL) function is T-bet dependent, since T-bet deficiency results in defective IL-21-dependent cytotoxicity in CD8+ T cells in vitro and in vivo.
23455505 T-bet and Eomes are likely regulated at the level of subcellular localization, potentially via different mechanisms.
23440501 expression of T-bet was increased in CD8 T cells from aged subjects
23413906 Data indicate that T-bet mRNA and the ratio of T-bet:GATA-3 mRNA in peripheral blood lymphocytes was lower in the chronic cardiac insufficiency (CCI) intervention group than in the CCI control group.
23334427 These results suggest that the imbalanced expression of Tim-3 and T-bet may play a role in the pathogenesis and course of aplastic anaemia (AA), and the downregulation of T-bet/Tim-3 may represent a reasonable therapeutic strategy for AA treatment.
23333304 HIV-1 Tat upregulates the expression of T-bet, Eomesdermin, Blimp-1, Bcl-6, and Bcl-2 in stimulated but not in unstimulated CD8+ T lymphocytes
23308012 Gene expression of T-bet and GATA-3 by endometrial stromal cells is controlled by hormonal conditions mimicking decidualization, and cyclic AMP.
23243425 The expression levels of Hlx, T-bet, and IFN-gamma were significantly decreased.
23095752 Data presented herein shed further light on involvement of T-bet in innate immunity and suggest that IL-36gamma, besides IFNgamma, may contribute to functions of this transcription factor in immunopathology.
22521571 The TBX21 promoter polymorphism T-1993C is associated with a significant decrease in IL-4 and IFN-c production by stimulated primary human lymphocytes.
22513824 measured the expression of T-bet (a member of the T-box family of transcription factors regulating Th1 lineage commitment) and its relationship with inflammation in 70 patients with transplant glomerulopathy
22490682 Chronic HIV infection affects the expression of the 2 transcription factors required for CD8 T-cell differentiation into cytolytic effectors.
22430437 These results implicate a mechanism through which T-bet may influence innate immunity in Crohn's disease.
22416188 Data suggest that TBX21 -1993 polymorphism might contribute to the risk of gastric cancer, especially to the distant metastasis.
22391183 Th1/Th2 imbalance exists in the acute phase of childhood Hench-Schonlein purpura, which correlates with the abnormal expression of transcription factor T-bet and GATA-3.
22336257 Leukocyte TBET/GATA3-binding factor mRNA ratio is elevated in patients with acute coronary syndrome, and highest in patients with acute myocardial infarction.
22303482 This study investigated the influence of TBX21 and HLX1 single nucleotide polymorphisms (SNPs), which have previously been shown to be associated with asthma, on T(H)1/T(H)2 lineage cytokines at birth.
22261438 mice lacking both transcription factors Eomesodermin (Eomes) and T-bet failed to develop NK cells
22258560 the T-1514C polymorphism affects TBX21 gene expression and Th1 cytokine production by binding USF-1 to the SNP site
22133489 Results indicate that single nucleotide polymorphisms in TBX21 and STAT4 might contribute to susceptibility to aplastic anemia (AA) in the Chinese population.
22014209 Functional polymorphisms in TBX21 are associated with the development of autoimmune thyroid diseases and prognosis of Graves' disease.
21780995 Data suggest that T-bet expression by B-cells represents a T-cell independent immune response trying to cope with opportunistic infections.
21642544 At the time point for rapid recall (6 h after stimulation), NF-kappaB, but not T-bet, is present in the nucleus of naive and memory CD4 T cells and exhibits a greater-fold upregulation in memory CD4 T cells.
21468546 The ratio of T-bet/GATA-3 can be used as an objective indicator of immune imbalance in patients with allergic asthma.
21289310 T-bet may play an important role in driving effector function, and its modulation may lead to enhanced effector activity against HIV.
21289214 predominance of intraglomerular T-bet expression relative to GATA3 expression associated with poor response to treatment with bolus steroid
21272048 Findings demonstrate that the TBX21 T-1993C polymorphism represses TBX21 expression and Th1 cytokine production through control of YY1, which might result in the imbalance between Th1 and Th2 immune responses in autoimmune or allergic diseases.
21239533 These results are the first to identify T-bet expression and activity in a structural cell of the lung and may provide new insights into therapeutic targets for inflammatory airway disease.
21177324 NZB treatment determines an accumulation of CD4+T-bet+, CD4+pSTAT3+ and CD8+T-bet+ T cells in the peripheral blood of natalizumab treated multiple sclerosis patients.
21114556 The T-bet deficiency and the correlation of GATA-3 expression with the increase of IgE are characteristics of long-lasting asthma.
21055151 The expression of T-bet correlates with the nasal NK/T-cell lymphoma types.
20977921 the T-1993C polymorphism in the TBX21 promoter influences susceptibility to type 1 autoimmune hepatitis in a Chinese population
20977921 Observational study of gene-disease association. (HuGE Navigator)
20974984 Downstream of interferon (IFN)-gamma, interleukin (IL)-27, and STAT1-activating cytokines there are both STAT1 and T-bet-dependent pathways capable of suppressing Th17 responses.
20855629 Data show that T-bet dependence identifies distinct transcriptional pathways in B cells that regulate IFN-gamma-induced switching to different IgG isotypes.
20713880 T-bet and Eomes are not critical for the generation of systemic cytotoxic T cell activities against cancer cells. Instead, T-bet and Eomes are crucial for tumor infiltration by CD8-positive T cells.
20675595 Dendritic cells transduced with recombinant adenovirus encoding full-length murine transgenic T-bet dramatically slow tumor progression and extend overall survival when delivered intralesionally.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20429676 Our results suggest that the TBX21 -1993C/-1514C haplotype may be a protective factor for genetic susceptibility to SLE in the Chinese population.
20429676 Observational study of gene-disease association. (HuGE Navigator)
20333526 higher expression in PBMC of psoriatic patients
20237292 In a transgenic mouse model, decreased GATA-3 and elevated T-bet are observed in Src family kinase Lck-deficient T helper (Th) type 2 skewed cells, and this suggests that inhibition of GATA-3, possibly by T-bet, may contribute to reduced IL-4 expression.
20193034 Data show that T-bet gene mutations may be associated with Th2-dominated condition in gastric cancers.
20175803 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20056084 T-bet and Eomes are important transcription factors for the regulation of IFN-gamma production in CD4(+) and CD8(+) T cells.
19950257 Single nucleotide polymorphisms in TBX21 and STAT4 contribute uniquely and interactively to SSc susceptibility.
19950257 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19923468 T-bet locus remodeling and expression are initiated by T cell receptor-induced NF-AT recruitment and amplified by interleukin (IL)12-mediated STAT4 binding to distinct distal regulatory elements during T helper (Th)1 cell differentiation.
19915058 a novel, IL-12-independent mechanism by which dendritic cell Tbets promote improved type 1 functional polarization from naive T cell responders
19879772 These results demonstrate how IL-18 activity is regulated by TNFalpha and TGF-beta1, and how IFNgamma production through regulation of IL-18 receptor and T-bet expression.
19861286 Compared with the normal controls, T-bet mRNA expression decreased whereas GATA-3 mRNA expression increased significantly in patients with systemic lupus erythematosus.
19818655 cooperation between architectural (CTCF) and transcriptional enhancing (T-bet) factors and the elements to which they bind is required for proper Th1 cell-specific expression of Ifng.
19805038 In Th1 cells, T-bet associates with genes of diverse function, including those with roles in transcriptional regulation, chemotaxis and adhesion.
19757302 The T-bet-IFN-gamma axis is involved in the pathogenesis of hairy-cell leukemia.
19692128 T-bet positive/RORgammat negative and T-bet positive/RORgammat positive clones induce experimental autoimmune encephalitis equally well.
19691533 chronic inflammatory demyelinating polyradiculoneuropathy(CDIP)patients with active disease showed higher pSTAT1, T-bet, & pSTAT3 in CD4(+) T-cells & monocytes than controls
19639723 upregulated expression in nasal polyps tissue in Chinese patients
19615257 T-bet and GATA-3 play a part role in the regulation of Th1/Th2 balance in esophageal cancer.
19535634 Unexpectedly, activated islet-reactive T cell receptor-transgenic (BDC2.5 TCR) T cells do not require Tbx21 in recipient mice for efficient adoptive transfer of experimental diabetes.
19473434 Observational study of gene-disease association. (HuGE Navigator)
19362685 increased expression in patients with systemic lupus erythematosus
19362357 A risk score model indicates that TBX21 and HLX1 polymorphisms may have synergistic effects on asthma risk.
19362357 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19348920 T-box 21 transcription factor is responsible for distorted T(H)2 differentiation in human peripheral CD4+ T cells.
19336263 increased levels in kidney and PBMC of patients with mesangial proliferative nephritis
19307156 these findings provide molecular insight into T-bet transcription and suggest that EGR1 is an upstream regulator of T-bet induction.
19298946 regulates late (but not early) IFN-g response in CD4 memory T cells
19287198 These results suggest that the polymorphisms of the TBX21 gene might be associated with the susceptibility to male rheumatoid arthritis patients.
19287198 Observational study of gene-disease association. (HuGE Navigator)
19269192 regulates effector CD8+ T cell differentiation into long-term memory cells
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19234223 A reduced number of invariant natural killer T (iNKT) cells present in T-bet-deficient transgenic mice does not prevent iNKT cells from playing a critical role in the development of airway hyperreactivity.
19176008 High expression of T-bet was related to the progress of severe aplastic anemia.
19168793 oral graft vs host disease results from type I IFN-driven immigration, proliferation, and differentiation of T-bet(+) type I T effectors
18840707 The Axl/Gas6 pathway contributes to normal human NK-cell development via an effect on the master regulatory transcription factor T-BET.
18753235 evaluated the frequencies of five different single-nucleotide polymorphisms (SNPs) in the TBX21 gene in 159 HSV-2-infected individuals and compared them with those in 186 healthy HSV-2-seronegative controls
18619618 T-bet mRNA expression level was significantly higher in patients with postoperative infection after aggressive hepatobiliary pancreatic surgery.
18504423 Observational study of gene-disease association. (HuGE Navigator)
18504404 IL-13 expression was downregulated by T-bet at the level of gene transcription, independently of the modulation of Th1/Th2 balance. T-bet is the potential key factor in the development of Th1/Th2-related diseases.
18414429 low-dose prolactin induced T-bet expression and high-dose prolactin tended to suppress it
18300036 HIV-1 Tat upregulates the expression of T-bet, Eomesdermin, Blimp-1, Bcl-6, and Bcl-2 in stimulated but not in unstimulated CD8+ T lymphocytes
18212358 The expression patterns of T-Bet and GATA-3 oppose progesteron receptor, suggesting antagonistic function and/or regulation between PR and T-Bet/GATA-3
17993020 T-bet expression was down-regulated in NALT of patients with allergic rhinitis.
17949803 Observational study of gene-disease association. (HuGE Navigator)
17949803 An association between a specific TBX21 haplotype and allergic asthma in children is demonstrated for the first time.
17705132 Sp1 is a positive transcriptional regulator of T-BET
17703412 Observational study of gene-disease association. (HuGE Navigator)
17667540 Immunohistochemical detection of T-bet in infiltrated bone marrow trephines represents an important adjunct for the diagnosis of hairy cell leukemia.
17541280 IL-4 gene transcription is inhibited by T-bet via the suppression of its promoter activity, independently of IFN-gamma. T-bet facilitates Th1 differentiation through not only upregulation of IFN-gamma, but also downregulation of IL-4 gene transcription.
17445473 In patients with acute asthma, rosiglitazone could regulate the balance of IFN-gamma and IL-4 by affecting expression of T-bet mRNA and GATA-3.
17445472 In Dermatophagoides farinae-stimulated PBMCs from patients with asthma, expression of GATA-3 and T-bet and FOPX3 expression is decreased.
17378728 Observational study of gene-disease association. (HuGE Navigator)
17378728 Genetic variations the TBX21 promoter region contribute to susceptibility to HBV infection in the Chinese population.
17325860 T-bet gene might be involved in the development of NK/T-cell lymphoma.
17237380 suppression of T-bet ameliorates EAE by limiting the differentiation of autoreactive Th1 cells, as well as inhibiting pathogenic Th17 cells via regulation of IL-23R.
17117487 There is an association between expression of Th1/Th2 transcription factors and cytokines (T-bet, GATA-3, IFN-gamma, IL-4,IL-18) in systemic lupus erythematosus.
17082665 A defect in Wiskott Aldrich CD4+ T cells is due to reduction in T-bet mRNA expression and in early nuclear recruitment of NFAT-1.
17075044 the GATA-3/T-bet transcription factor complex regulates the cell-lineage-specific expression of the lymphocyte homing receptors
17074191 Imbalance of transcription factors T-bet and GATA-3 may be one of the key factors in immune dysregulation of recurrent aphthous ulcerations.
16874959 Among mite-allergic patients T-bet expression was down-regulated, which had no relation to ECP concentration and allergic symptoms.
16750991 Observational study of gene-disease association. (HuGE Navigator)
16498264 Segmental allergen challenge in asthmatics leads to increased GATA-3, c-maf and T-bet expression in BAL cells but not in bronchial biopsies
16487356 Increased T-bet expression does not only identify intracellular infections in lymphoid tissue associated with high IFN-gamma levels, but also implies that, under these conditions, it becomes induced in B cells, which apparently support the Th1 response.
16434488 Increased IFN-gamma levels observed in aplastic anemia patients are the result of active transcription of the IFN-gamma gene by T-bet.
16273099 A key transcription factor that links the long-term renewal of memory CD8+ T cells to their characteristic effector potency.
16210653 Data from a prospective twin study suggest that T helper type 2 (Th2) cell-associated diseases in humans might be due to genetic variations in Th1 cytokine regulation via T-bet.
16179640 Observational study of gene-disease association. (HuGE Navigator)
16179640 These data suggest that T-bet variation contributes to airway responsiveness in asthma.
15927679 T-bet was clearly induced in the two B-cell precursor-leukemia cell lines.
15860546 female steroid hormones use Stat-mediated pathways to modulate the expression of T-bet in epithelial cells
15806396 first report demonstrating relationship between TBX21 single nucleotide polymorphisms and aspirin-induced asthma in Japanese
15737643 HIV-1 Tat upregulates the expression of T-bet, Eomesdermin, Blimp-1, Bcl-6, and Bcl-2 in stimulated but not in unstimulated CD8+ T lymphocytes
15712176 T-bet may play a role in Hodgkin's lymphoma oncogenesis
15684083 Data indicate that T-bet can override repressive epigenetic modification through a T-box half-site and dissociation of the mSin3a corepressor from the promoter.
15632006 Expressed in Hodgkin disesase Reed Sternberg cells.
15604153 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15604153 genetic variation in TBX21 may alter asthma phenotypes in a treatment-specific fashion
15248849 Observational study of gene-disease association. (HuGE Navigator)
15241679 Association seen between type 1 diabetes and polymorphisms in the T-bet gene; variation in T-bet transcriptional activity may play a role in the development of type 1 diabetes, possibly through the effect on IFN-gamma production in Th1 cells
15131585 T-bet expression in T(H)2 cells induced IL-2 production and decreased the secretion of IL-4.
12960249 VZV virus and mite antigens induce expression of this transcriptionn factor in cord blood mononuclear cells, differenetially affecting Th1 and Th2 cells.
12938094 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12938094 Among twenty-three novel polymorphisms identified in the human TBX21 gene of Korean asthma patients, no significant associations of TBX21 variants with risk of asthma were observed.
12128215 distribution of T-BET/TBX21 expression in the haematopoietic compartment

AA Sequence

MGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSR      1 - 70
FLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPGPREDYALPAGLEVSGKLRVA     71 - 140
LNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKA    141 - 210
EGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEP    211 - 280
EAACNASNTHIFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNCQFL    281 - 350
GGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYY    351 - 420
RGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDS    421 - 490
GLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN                             491 - 535
//

Text Mined References (158)

PMID Year Title
27082299 2016 Association of T-Bet, GATA-3, RORC, and FOXP3 Copy Number Variations With Acute Anterior Uveitis With or Without Ankylosing Spondylitis in Chinese Han.
26950239 2016 A molecular threshold for effector CD8(+) T cell differentiation controlled by transcription factors Blimp-1 and T-bet.
26809262 2016 T-bet expression in CD8+ T cells associated with chronic hepatitis B virus infection.
26762769 2016 The low EOMES/TBX21 molecular phenotype in multiple sclerosis reflects CD56+ cell dysregulation and is affected by immunomodulatory therapies.
26520896 2015 IFN-?-producing Th17 cells bias by HMGB1-T-bet/RUNX3 axis might contribute to progression of coronary artery atherosclerosis.
26438526 2015 NK Cell Functional Impairment after Allogeneic Hematopoietic Stem Cell Transplantation Is Associated with Reduced Levels of T-bet and Eomesodermin.
26418311 2015 Intranasal Administration of Lentiviral miR-135a Regulates Mast Cell and Allergen-Induced Inflammation by Targeting GATA-3.
26302932 Elevated expression of T-bet in mycobacterial antigen-specific CD4(+) T cells from patients with tuberculosis.
26297793 2015 Age-Associated B Cells: A T-bet-Dependent Effector with Roles in Protective and Pathogenic Immunity.
26214042 2015 The Clinical Significance of Abnormal Tim-3 Expression on NK Cells from Patients with Gastric Cancer.
25873156 2015 Copy number variants and genetic polymorphisms in TBX21, GATA3, Rorc, Foxp3 and susceptibility to Behcet's disease and Vogt-Koyanagi-Harada syndrome.
25832120 2015 TBX21-1993T/C (rs4794067) polymorphism is associated with increased risk of chronic periodontitis and increased T-bet expression in periodontal lesions, but does not significantly impact the IFN-g transcriptional level or the pattern of periodontophatic bacterial infection.
25759111 2015 TBX21 polymorphisms are associated with virus persistence in hepatitis C virus infection patients from a high-risk Chinese population.
25577251 2015 Association between the genetic variations within TBX21 gene promoter and the clinicopathological characteristics of esophageal squamous cell carcinoma in a high-risk Chinese population.
25575062 2015 [Th2 differentiation features of Mycobacterium tuberculosis heat resistant antigen-activated human ??T cells and the regulation of transcription factor T-bet/GATA-3 on differentiation].
25552913 2015 The expression levels of transcription factors T-bet, GATA-3, ROR?t and FOXP3 in peripheral blood lymphocyte (PBL) of patients with liver cancer and their significance.
25505279 2015 Chronic lymphocytic leukemia cells express CD38 in response to Th1 cell-derived IFN-? by a T-bet-dependent mechanism.
25495780 2015 Knockdown of T-bet expression in Mart-127-35 -specific T-cell-receptor-engineered human CD4(+)  CD25(-) and CD8(+) T cells attenuates effector function.
25400774 2014 T-box transcription factor 21 expression in breast cancer and its relationship with prognosis.
25378399 2014 Human memory, but not naive, CD4+ T cells expressing transcription factor T-bet might drive rapid cytokine production.
25352127 2014 TOX2 regulates human natural killer cell development by controlling T-BET expression.
25340608 2015 The transcription factor, T-bet, primes intestine transplantation rejection and is associated with disrupted mucosal homeostasis.
25339676 2014 T-bet:Eomes balance, effector function, and proliferation of cytomegalovirus-specific CD8+ T cells during primary infection differentiates the capacity for durable immune control.
25292313 2015 The effects of galectin-1 on the gene expression of the transcription factors TBX21, GATA-3, FOXP3 and RORC.
25225458 2014 Dysfunctional CD8+ T cells in hepatitis B and C are characterized by a lack of antigen-specific T-bet induction.
25056814 2014 Genetic variation of TBX21 gene increases risk of asthma and its severity in Indian children.
25032686 2014 T-bet and Eomes are differentially linked to the exhausted phenotype of CD8+ T cells in HIV infection.
24901011 2014 The role of protein modifications of T-bet in cytokine production and differentiation of T helper cells.
24845384 2014 Deubiquitination and stabilization of T-bet by USP10.
24766459 2014 Insufficient interleukin-12 signalling favours differentiation of human CD4(+) and CD8(+) T cells into GATA-3(+) and GATA-3(+) T-bet(+) subsets in humanized mice.
24660543 2014 Research on the roles of transcription factors T-bet and GATA-3 in aplastic anemia.
24495857 2014 The autoimmune disease-associated transcription factors EOMES and TBX21 are dysregulated in multiple sclerosis and define a molecular subtype of disease.
24338248 2014 Downregulation of T-bet/GATA-3 ratio induced by IL-11 treatment is responsible for Th1/Th2 balance restoration in human immune thrombocytopenic purpura (ITP).
24262372 2014 The polymorphisms of T cell-specific TBX21 gene may contribute to the susceptibility of chronic immune thrombocytopenia in Chinese population.
24235972 2013 The diagnostic value of transcription factors T-bet/GATA3 ratio in predicting antibody-mediated rejection.
24107858 2013 Asthma treatment outcome in adults is associated with rs9910408 in TBX21 gene.
23855758 2013 Nodal reactive and neoplastic proliferation of monocytoid and marginal zone B cells: an immunoarchitectural and molecular study highlighting the relevance of IRTA1 and T-bet as positive markers.
23608226 2013 Epstein-Barr virus-encoded miR-BART20-5p inhibits T-bet translation with secondary suppression of p53 in invasive nasal NK/T-cell lymphoma.
23607257 2014 Marginal zone lymphomas with monocytoid morphology express T-bet and are associated with a low number of T cells in extranodal locations.
23479229 2013 IL-21 promotes CD8+ CTL activity via the transcription factor T-bet.
23455505 2013 Differential localization of T-bet and Eomes in CD8 T cell memory populations.
23440501 2013 Increased T-bet is associated with senescence of influenza virus-specific CD8 T cells in aged humans.
23413906 2013 Effect of immune modulation therapy on cardiac function and T-bet/GATA-3 gene expression in aging male patients with chronic cardiac insufficiency.
23334427 2013 Imbalanced expression of T-bet and T cell immunoglobulin mucin-3 in patients with aplastic anaemia.
23308012 2013 Modulation of the expression of the transcription factors T-bet and GATA-3 in immortalized human endometrial stromal cells (HESCs) by sex steroid hormones and cAMP.
23243425 2012 Downregulation of Hlx closely related to the decreased expressions of T-bet and Runx3 in patients with gastric cancer may be associated with a pathological event leading to the imbalance of Th1/Th2.
23095752 2012 IL-36?/IL-1F9, an innate T-bet target in myeloid cells.
22521571 2012 The TBX21 transcription factor T-1993C polymorphism is associated with decreased IFN-? and IL-4 production by primary human lymphocytes.
22513824 2012 Endothelial injury in transplant glomerulopathy is correlated with transcription factor T-bet expression.
22490682 2012 Chronic HIV infection affects the expression of the 2 transcription factors required for CD8 T-cell differentiation into cytolytic effectors.
22430437 2009 In silico analysis of T-bet activity in peripheral blood mononuclear cells in patients with inflammatory bowel disease (IBD).
22416188 2012 Association between gastric cancer and -1993 polymorphism of TBX21 gene.
22391183 2012 [Effects of transcription factor T-bet, GATA-3, FoxP3 and CD4(+)CD25(+)regulatory T cells in pathogenesis of child Hench-Schonlein purpura].
22336257 2012 Circulating leukocyte TBET and GATA3 mRNA in patients with acute coronary syndrome.
22303482 2012 TBX21 and HLX1 polymorphisms influence cytokine secretion at birth.
22261438 2012 The transcription factors T-bet and Eomes control key checkpoints of natural killer cell maturation.
22258560 2012 The role of upstream stimulatory factor 1 in the transcriptional regulation of the human TBX21 promoter mediated by the T-1514C polymorphism associated with systemic lupus erythematosus.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
22133489 2012 The polymorphisms of T cell-specific TBX21 and STAT4 genes may contribute to the susceptibility of Chinese individuals to aplastic anemia.
22014209 2012 Functional polymorphisms in TBX21 and HLX are associated with development and prognosis of Graves' disease.
21780995 2012 Three different expression patterns of T-bet in angioimmunoblastic T-cell lymphoma.
21642544 2011 Transcriptional control of rapid recall by memory CD4 T cells.
21468546 Correlation between the ratio of T-bet/GATA-3 and the levels of IL-4 and IFN-? in patients with allergic asthma.
21289310 2011 Increased HIV-specific CD8+ T-cell cytotoxic potential in HIV elite controllers is associated with T-bet expression.
21289214 2011 Predominance of intraglomerular T-bet or GATA3 may determine mechanism of transplant rejection.
21272048 2011 A common promoter variant of TBX21 is associated with allele specific binding to Yin-Yang 1 and reduced gene expression.
21239533 2011 T-bet is induced by interferon-? to mediate chemokine secretion and migration in human airway smooth muscle cells.
21177324 2011 CD4+T-bet+, CD4+pSTAT3+ and CD8+T-bet+ T cells accumulate in peripheral blood during NZB treatment.
21114556 2011 FoxP3, GATA-3 and T-bet expression in elderly asthma.
21055151 2010 [Expression of natural killer cell development-associated transcription factors in nasal NK/T-cell lymphomas occurring in Chinese population].
20977921 2011 Association of TBX21 promoter polymorphisms with type 1 autoimmune hepatitis in a Chinese population.
20974984 2010 STAT1-activating cytokines limit Th17 responses through both T-bet-dependent and -independent mechanisms.
20855629 2010 IFN-{gamma} produced by CD8 T cells induces T-bet-dependent and -independent class switching in B cells in responses to alum-precipitated protein vaccine.
20713880 2010 T-bet and eomesodermin are required for T cell-mediated antitumor immune responses.
20675595 2010 Intralesional delivery of dendritic cells engineered to express T-bet promotes protective type 1 immunity and the normalization of the tumor microenvironment.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20583921 2010 T-bet, GATA-3, and Foxp3 expression and Th1/Th2 cytokine production in the clinical outcome of human infection with Leishmania (Viannia) species.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20429676 2010 Association of TBX21 gene haplotypes in a Chinese population with systemic lupus erythematosus.
20333526 2010 Expression of Th1 and Th2 cytokine-associated transcription factors, T-bet and GATA-3, in peripheral blood mononuclear cells and skin lesions of patients with psoriasis vulgaris.
20237292 2010 Lck mediates Th2 differentiation through effects on T-bet and GATA-3.
20193034 2010 The mutations of Th1 cell-specific T-box transcription factor may be associated with a predominant Th2 phenotype in gastric cancers.
20175803 2009 Pharmacogenetic study of the effects of NK2R G231E G>A and TBX21 H33Q C>G polymorphisms on asthma control with inhaled corticosteroid treatment.
20056084 2010 [Role of transcription factor T-bet and Eomes in IFN-gamma secretion of different human T cell subsets].
19950257 2009 Polymorphisms in TBX21 and STAT4 increase the risk of systemic sclerosis: evidence of possible gene-gene interaction and alterations in Th1/Th2 cytokines.
19923468 2009 Integration of distinct intracellular signaling pathways at distal regulatory elements directs T-bet expression in human CD4+ T cells.
19915058 2009 Ectopic T-bet expression licenses dendritic cells for IL-12-independent priming of type 1 T cells in vitro.
19879772 2010 TNFalpha and TGF-beta1 influence IL-18-induced IFNgamma production through regulation of IL-18 receptor and T-bet expression.
19861286 2009 [Expression of transcription factors T-bet and GATA-3 in peripheral blood mononuclear cells from patients with systemic lupus erythematosus].
19818655 2009 CCCTC-binding factor and the transcription factor T-bet orchestrate T helper 1 cell-specific structure and function at the interferon-gamma locus.
19805038 2009 The transcription factors T-bet and GATA-3 control alternative pathways of T-cell differentiation through a shared set of target genes.
19757302 2009 T-box-expressed-in-T-cells (T-bet) expression by the tumor cells of hairy-cell leukemia correlates with interferon-gamma production.
19692128 2009 Encephalitogenic T cells that stably express both T-bet and ROR gamma t consistently produce IFNgamma but have a spectrum of IL-17 profiles.
19691533 2009 pSTAT1, pSTAT3, and T-bet as markers of disease activity in chronic inflammatory demyelinating polyradiculoneuropathy.
19639723 2009 Characterizing T-cell phenotypes in nasal polyposis in Chinese patients.
19615257 2009 [Expression of transcription factor T-bet and GATA-3 in peripheral blood mononuclear cells and its correlation with immune status in esophageal cancer patients].
19535634 2009 T-bet-deficient NOD mice are protected from diabetes due to defects in both T cell and innate immune system function.
19473434 2009 Association of TBX21 T-1993C polymorphism with viral persistence but not disease progression in hepatitis B virus carriers.
19362685 2009 The expressions of Toll-like receptor 9 and T-bet in circulating B and T cells in newly diagnosed, untreated systemic lupus erythematosus and correlations with disease activity and laboratory data in a Chinese population.
19362357 2009 TBX21 gene variants increase childhood asthma risk in combination with HLX1 variants.
19348920 2009 T-box 21 transcription factor is responsible for distorted T(H)2 differentiation in human peripheral CD4+ T cells.
19336263 2009 Immunoregulatory effects of sinomenine on the T-bet/GATA-3 ratio and Th1/Th2 cytokine balance in the treatment of mesangial proliferative nephritis.
19307156 2009 T-bet expression is regulated by EGR1-mediated signaling in activated T cells.
19298946 2009 Biochemical signaling pathways for memory T cell recall.
19287198 2009 Association of TBX21 polymorphisms in a Korean population with rheumatoid arthritis.
19269192 2009 Surviving the crash: transitioning from effector to memory CD8+ T cell.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19234223 2009 The development of airway hyperreactivity in T-bet-deficient mice requires CD1d-restricted NKT cells.
19176008 2008 [Study on the dendritic cell subsets in peripheral blood and its relationship with the expressions of T-bet and GATA-3 in lymphocytes in severe aplastic anemia].
19168793 2009 Increased T-bet+ cytotoxic effectors and type I interferon-mediated processes in chronic graft-versus-host disease of the oral mucosa.
18840707 2009 The Axl/Gas6 pathway is required for optimal cytokine signaling during human natural killer cell development.
18753235 2008 A 3'-untranslated region polymorphism in the TBX21 gene encoding T-bet is a risk factor for genital herpes simplex virus type 2 infection in humans.
18619618 2009 Preoperative GATA3 mRNA expression in peripheral blood mononuclear cells is up-regulated in patients with postoperative infection following hepatobiliary pancreatic surgery.
18504423 2008 Polymorphisms in inflammation-related genes are associated with susceptibility to major depression and antidepressant response.
18504404 2008 Downregulation of IL-13 gene transcription by T-bet in human T cells.
18414429 2008 Prolactin can modulate CD4+ T-cell response through receptor-mediated alterations in the expression of T-bet.
18212358 2008 Cyclic regulation of T-Bet and GATA-3 in human endometrium.
17993020 2007 [Expression of T-bet in nasopharyngeal associated lymphatic tissue of patients with allergic rhinitis].
17949803 2008 T cell-specific T-box transcription factor haplotype is associated with allergic asthma in children.
17705132 2007 Transcriptional control of human T-BET expression: the role of Sp1.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17667540 2007 T-bet transcription factor detection facilitates the diagnosis of minimal hairy cell leukemia infiltrates in bone marrow trephines.
17541280 2007 IL-4 gene transcription in human T cells is suppressed by T-bet.
17445473 2007 [Effect of rosiglitazone on the expression of T-bet/GATA-3 in T lymphocytes in patients with acute asthma].
17445472 2007 [Expression of T-bet, GATA-3 and FOXP3 mRNA in asthmatic peripheral blood mononuclear cells stimulated by Dermatophagoides farinae antigen].
17378728 2007 Association analysis of hepatitis virus B infection with haplotypes of the TBX21 gene promoter region in the Chinese population.
17325860 2007 Amplification and specific expression of T-bet gene in nasal NK/T-cell lymphoma.
17237380 2007 T-bet regulates the fate of Th1 and Th17 lymphocytes in autoimmunity.
17117487 2007 Elevated gene expression of Th1/Th2 associated transcription factors is correlated with disease activity in patients with systemic lupus erythematosus.
17082665 2006 Defective Th1 cytokine gene transcription in CD4+ and CD8+ T cells from Wiskott-Aldrich syndrome patients.
17075044 2006 Interaction of GATA-3/T-bet transcription factors regulates expression of sialyl Lewis X homing receptors on Th1/Th2 lymphocytes.
17074191 2006 [Expression of T cell-specific transcription factors T-bet and GATA-3 in recurrent aphthous ulcerations].
16874959 2005 [Expression of T-bet and its relation with IgE and eosinophil cationic protein in patients with allergic rhinitis].
16750991 2006 Association of IL13 with total IgE: evidence against an inverse association of atopy and diabetes.
16498264 2006 Regulation of GATA-3, c-maf and T-bet mRNA expression in bronchoalveolar lavage cells and bronchial biopsies after segmental allergen challenge.
16487356 2006 Different T-bet expression patterns characterize particular reactive lymphoid tissue lesions.
16434488 2006 T-bet, a Th1 transcription factor, is up-regulated in T cells from patients with aplastic anemia.
16273099 2005 Effector and memory CD8+ T cell fate coupled by T-bet and eomesodermin.
16210653 2005 A genetic basis for IFN-gamma production and T-bet expression in humans.
16179640 2006 T-bet polymorphisms are associated with asthma and airway hyperresponsiveness.
15927679 2005 Transcription factor expression in B-cell precursor-leukemia cell lines: preferential expression of T-bet.
15860546 2005 Female steroid hormones use signal transducers and activators of transcription protein-mediated pathways to modulate the expression of T-bet in epithelial cells: a mechanism for local immune regulation in the human reproductive tract.
15806396 2005 Functional promoter polymorphism in the TBX21 gene associated with aspirin-induced asthma.
15712176 2005 T-bet, a T cell-associated transcription factor, is expressed in Hodgkin's lymphoma.
15684083 2005 T-bet antagonizes mSin3a recruitment and transactivates a fully methylated IFN-gamma promoter via a conserved T-box half-site.
15632006 2005 Expression of the T-cell transcription factors, GATA-3 and T-bet, in the neoplastic cells of Hodgkin lymphomas.
15604153 2004 TBX21: a functional variant predicts improvement in asthma with the use of inhaled corticosteroids.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15248849 2004 Association study of 15 novel single-nucleotide polymorphisms of the T-bet locus among Finnish asthma families.
15241679 2004 Identification of a novel type 1 diabetes susceptibility gene, T-bet.
15131585 2004 Sustained T-bet expression confers polarized human TH2 cells with TH1-like cytokine production and migratory capacities.
12960249 2003 Different antigens trigger different Th1/Th2 reactions in neonatal mononuclear cells (MNCs) relating to T-bet/GATA-3 expression.
12938094 2003 Association analysis of novel TBX21 variants with asthma phenotypes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12128215 2002 Developmental expression of the T-box transcription factor T-bet/Tbx21 during mouse embryogenesis.
11087660 2000 Cloning and characterization of a new member of the T-box gene family.
10761931 2000 A novel transcription factor, T-bet, directs Th1 lineage commitment.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.