Property Summary

NCBI Gene PubMed Count 177
PubMed Score 868.52
PubTator Score 319.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 2.0e-03
lung adenocarcinoma -1.200 1.8e-07
osteosarcoma -1.502 8.5e-04
psoriasis 1.400 2.2e-26

Gene RIF (182)

AA Sequence

MGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSR      1 - 70
FLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPGPREDYALPAGLEVSGKLRVA     71 - 140
LNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKA    141 - 210
EGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEP    211 - 280
EAACNASNTHIFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNCQFL    281 - 350
GGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYY    351 - 420
RGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDS    421 - 490
GLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN                             491 - 535
//

Text Mined References (178)

PMID Year Title