Property Summary

NCBI Gene PubMed Count 21
PubMed Score 139.23
PubTator Score 45.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.200 4.6e-08
astrocytoma -1.200 5.6e-03
glioblastoma -1.200 3.6e-04
lung cancer 1.400 2.2e-04
adult high grade glioma -1.200 1.8e-04
ovarian cancer 1.500 9.0e-04

Synonym

Accession P62380 A8K8F5 O95753 Q9BWD5 Q9Z2Z0 TBP-like protein 1
Symbols TLF
TLP
STUD
TRF2
MGC:8389
MGC:9620

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (9)

PMID Text
26398009 miR18a exhibits a protective role in colorectal cancer (CRC) via inhibiting proliferation, invasion and migration of CRC cells by directly targeting the TBPL1 gene.
24870791 Western blotting and immunohistochemistry both indicated a higher TBPL1 protein expression level in colorectal cancer tissue. siRNA for TBPL1 transfection obviously slowed down the cell proliferation in both SW-620 and HT-29 cells.
24594805 results suggest that activation of the p21 upstream promoter is mediated by interaction between specific regions of TLP and p53
22511763 TLP mediates p53-governed transcriptional activation of the p21 upstream promoter.
19858204 the knockdown of the endogenous TLP reduced etoposide-induced apoptosis through repression of TAp63 expression. Taken together, our present study identifies a TLP-TAp63 pathway that is further implicated in stress-induced apoptosis.
19369647 Observational study of gene-disease association. (HuGE Navigator)
15767669 TLF is a functional regulator of transcription with targets distinct from those of TBP.
15673318 Observational study of gene-disease association. (HuGE Navigator)
15269281 Data show that during interphase, endogenous or exogenously expressed TRF2 is located almost exclusively in the nucleolus

AA Sequence

MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTG      1 - 70
ATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCY     71 - 140
RIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEIL                            141 - 186
//

Text Mined References (25)

PMID Year Title
26398009 2015 Tumor suppressor microRNA-18a regulates tumor proliferation and invasion by targeting TBPL1 in colorectal cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24958592 2014 TRF2, but not TBP, mediates the transcription of ribosomal protein genes.
24870791 2014 MiR-133b acts as a tumor suppressor and negatively regulates TBPL1 in colorectal cancer cells.
24835508 2014 Activity of the upstream TATA-less promoter of the p21(Waf1/Cip1) gene depends on transcription factor IIA (TFIIA) in addition to TFIIA-reactive TBP-like protein.
24594805 2014 Interaction between transactivation domain of p53 and middle part of TBP-like protein (TLP) is involved in TLP-stimulated and p53-activated transcription from the p21 upstream promoter.
22511763 2012 TATA-binding protein (TBP)-like protein is required for p53-dependent transcriptional activation of upstream promoter of p21Waf1/Cip1 gene.
21269460 2011 Initial characterization of the human central proteome.
19858204 2009 TATA-binding Protein (TBP)-like Protein Is Engaged in Etoposide-induced Apoptosis through Transcriptional Activation of Human TAp63 Gene.
19369647 2009 Identification of potentially damaging amino acid substitutions leading to human male infertility.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
17570761 2007 Genomics, evolution, and expression of TBPL2, a member of the TBP family.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15767669 2005 TATA-binding protein (TBP)-like factor (TLF) is a functional regulator of transcription: reciprocal regulation of the neurofibromatosis type 1 and c-fos genes by TLF/TRF2 and TBP.
15673318 2005 Iron overload in kidney transplants: prospective analysis of biochemical and genetic markers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15269281 2004 Cell-specific nucleolar localization of TBP-related factor 2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11861477 2002 Distinct functions of TBP and TLF/TRF2 during spermatogenesis: requirement of TLF for heterochromatic chromocenter formation in haploid round spermatids.
10570139 1999 Human TATA-binding protein-related factor-2 (hTRF2) stably associates with hTFIIA in HeLa cells.
10220372 1999 TATA box-binding protein (TBP)-related factor 2 (TRF2), a third member of the TBP family.
10082669 1999 Isolation of cDNA, chromosome mapping, and expression of the human TBP-like protein.
9889269 1999 Identification of a mouse TBP-like protein (TLP) distantly related to the drosophila TBP-related factor.