Property Summary

NCBI Gene PubMed Count 34
PubMed Score 68.05
PubTator Score 594.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

Gene RIF (19)

PMID Text
26708416 in splenic hemangioma with t(3;6)(q26;p21), the entire coding region of HMGA1 comes under the control of the TBL1XR1 promoter, bringing about dysregulation of HMGA1
26386862 These finding suggested that TBLR1 is likely to be a potential prognostic indicator and therapeutic target for HCC and that TBLR1 may be implicated in EMT of HCC cells.
25425123 that TBL1XR1 haploinsufficiency can cause intellectual disability with a recognizable dysmorphism, without necessarily causing autistic behavior.
25341494 TBLR1 plays a key role in the development and progression of breast cancer cells via cyclin D1-transactivation and activation of the beta-catenin signaling pathway.
25145705 Results show that upregulation of TBL1XR1 induces Nasopharyngeal Carcinoma cells resistance to cisplatin by activating the NF-kappaB pathway.
25102098 Patient with TBL1XR1 mutation [c.209 G>A (p.Gly70Asp)] leading to West syndrome with Rett-like features, together with autistic features was reported.
24895125 data indicate that loss of TBL1XR1 is a novel driver of glucocorticoid resistance in ALL and that epigenetic therapy may have future application in restoring drug sensitivity at relapse.
24874481 The TBLR1 protein may be a prognostic marker in cervical cancer and play an important role in the invasion and metastasis of human cervical cancer
24667177 results demonstrated that TBL1XR1 induced lymphangiogenesis and lymphatic metastasis in esophageal squamous cell carcinoma via upregulation of VEGF-C, and may represent a novel prognostic biomarker and therapeutic target for patients with ESCC.
24243687 Stable ectopic expression of TBLR1 leads to androgen-dependent growth suppression of prostate cancer cells by selective activation of androgen-regulated genes associated with differentiation and growth suppression but not cell proliferation.
22837180 Our study provides new insights into the molecular tumorigenesis of PCNSL and identifies novel genetic alterations in this disease, especially MYD88 and TBL1XR1 mutations activating the NF-kappaB signaling pathway.
22496164 TBL1XR1/TP63: a novel recurrent gene fusion in B-cell non-Hodgkin lymphoma.
22190034 HIV-1 Rev is identified to have a physical interaction with transducin (beta)-like 1 X-linked receptor 1 (TBL1XR1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18767146 the TBL1XR1 gene was significantly under-expressed in acute lymphoblastic leukemia.
18193033 Wnt signalling induced the interaction between beta-catenin and TBL1-TBLR1, as well as their binding to Wnt target genes. Importantly, the recruitment of TBL1-TBLR1 and beta-catenin to Wnt target-gene promoters was mutually dependent on each other.
17316888 A cDNA library consisting of 220 upregulated genes in tumour tissue was established and named as LSCC. Differential expression was confirmed in five of these genes, including IGFBP5, SQLE, RAP2B, CLDN1, and TBL1XR1.
16893456 TBLR1 is a multifunctional co-repressor of transcription
15601853 TBL1 and TBLR1 are functionally redundant and essential for transcriptional repression by unliganded thyroid hormone receptors (TR) but not essential for transcriptional activation by liganded TR

AA Sequence

MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYVEAEVSINEDG      1 - 70
TLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAASQQGSAKNGENTANGEENGAHT     71 - 140
IANNHTDMMEVDGDVEIPPNKAVVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLV    141 - 210
LRHCIREGGQDVPSNKDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNF    211 - 280
ILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTN    281 - 350
EVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASF    351 - 420
DSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYRGTGGIFEVC    421 - 490
WNAAGDKVGASASDGSVCVLDLRK                                                  491 - 514
//

Text Mined References (45)

PMID Year Title
27221108 2016 Erratum: A specific mutation in TBL1XR1 causes Pierpont syndrome.
27133561 2016 Syndrome disintegration: Exome sequencing reveals that Fitzsimmons syndrome is a co-occurrence of multiple events.
26769062 2016 A specific mutation in TBL1XR1 causes Pierpont syndrome.
26708416 2016 Fusion of the TBL1XR1 and HMGA1 genes in splenic hemangioma with t(3;6)(q26;p21).
26386862 2016 Transducin (Beta)-Like 1 X-Linked Receptor 1 Correlates with Clinical Prognosis and Epithelial-Mesenchymal Transition in Hepatocellular Carcinoma.
25425123 2015 A new syndrome of intellectual disability with dysmorphism due to TBL1XR1 deletion.
25416956 2014 A proteome-scale map of the human interactome network.
25341494 2014 Transducin (?)-like 1 X-linked receptor 1 promotes proliferation and tumorigenicity in human breast cancer via activation of beta-catenin signaling.
25145705 2014 Transducin ?-like 1 X-linked receptor 1 suppresses cisplatin sensitivity in nasopharyngeal carcinoma via activation of NF-?B pathway.
25102098 2014 A girl with West syndrome and autistic features harboring a de novo TBL1XR1 mutation.
24895125 2014 Loss of TBL1XR1 disrupts glucocorticoid receptor recruitment to chromatin and results in glucocorticoid resistance in a B-lymphoblastic leukemia model.
24891185 2014 De novo deletion of TBL1XR1 in a child with non-specific developmental delay supports its implication in intellectual disability.
24874481 2014 TBLR1 is a novel prognostic marker and promotes epithelial-mesenchymal transition in cervical cancer.
24667177 2015 TBL1XR1 promotes lymphangiogenesis and lymphatic metastasis in esophageal squamous cell carcinoma.
24243687 2014 TBLR1 as an androgen receptor (AR) coactivator selectively activates AR target genes to inhibit prostate cancer growth.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160955 2012 Multiplex targeted sequencing identifies recurrently mutated genes in autism spectrum disorders.
22837180 2012 Recurrent mutations of MYD88 and TBL1XR1 in primary central nervous system lymphomas.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22496164 2012 TBL1XR1/TP63: a novel recurrent gene fusion in B-cell non-Hodgkin lymphoma.
22495309 2012 Sporadic autism exomes reveal a highly interconnected protein network of de novo mutations.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21642993 2011 Genome-wide association study identifies three new susceptibility loci for esophageal squamous-cell carcinoma in Chinese populations.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18767146 2008 The complex genomic profile of ETV6-RUNX1 positive acute lymphoblastic leukemia highlights a recurrent deletion of TBL1XR1.
18374649 2008 TBL1 and TBLR1 phosphorylation on regulated gene promoters overcomes dual CtBP and NCoR/SMRT transcriptional repression checkpoints.
18326024 2008 Histone deacetylase 3 localizes to the mitotic spindle and is required for kinetochore-microtubule attachment.
18193033 2008 TBL1-TBLR1 and beta-catenin recruit each other to Wnt target-gene promoter for transcription activation and oncogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17316888 2007 Identification of genes differentially expressed in human primary lung squamous cell carcinoma.
16893456 2006 TBLR1 regulates the expression of nuclear hormone receptor co-repressors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15601853 2005 Reading and function of a histone code involved in targeting corepressor complexes for repression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14980219 2004 A corepressor/coactivator exchange complex required for transcriptional activation by nuclear receptors and other regulated transcription factors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12628926 2003 Purification and functional characterization of the human N-CoR complex: the roles of HDAC3, TBL1 and TBLR1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11931768 2002 The N-CoR-HDAC3 nuclear receptor corepressor complex inhibits the JNK pathway through the integral subunit GPS2.
11063877 2000 Identification of four human cDNAs that are differentially expressed by early hematopoietic progenitors.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.