Property Summary

Ligand Count 83
NCBI Gene PubMed Count 183
PubMed Score 569.15
PubTator Score 340.02

Knowledge Summary

Patent (19,375)

TINX Plot

  Disease (8)

Disease Target Count P-value
ovarian cancer 8520 6.8e-06
medulloblastoma, large-cell 6241 1.8e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Glaucoma 239 3.623 1.8
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.100 1.8e-05
ovarian cancer 1.600 6.8e-06

Protein-protein Interaction (1)

Gene RIF (136)

AA Sequence

MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKL      1 - 70
FAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGN     71 - 140
IMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVT    141 - 210
FYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPV    211 - 280
LANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQ    281 - 350
ELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITG    351 - 420
VVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINL    421 - 490
EAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMT    491 - 560
EIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQL    561 - 630
LSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGV    631 - 700
VKELAENNHILERFGSLTMDGGLRNVDCL                                             701 - 729
//

Text Mined References (200)

PMID Year Title