Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.87
PubTator Score 14.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.1e-07
ependymoma 1.200 5.1e-03
glioblastoma -1.100 2.6e-05
group 4 medulloblastoma 1.100 1.3e-03
intraductal papillary-mucinous carcinoma... -1.400 4.4e-03
juvenile dermatomyositis 1.231 1.2e-10
lung cancer -1.400 7.5e-03
malignant mesothelioma 1.900 6.4e-07
medulloblastoma, large-cell -1.100 5.3e-05
osteosarcoma -1.025 3.3e-03
ovarian cancer -1.900 2.0e-08
pancreatic ductal adenocarcinoma liver m... -2.057 1.6e-03
pediatric high grade glioma -1.100 7.9e-07
ulcerative colitis 1.300 4.0e-02

Gene RIF (3)

AA Sequence

MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIA      1 - 70
AFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASW     71 - 140
ETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANN    141 - 210
HLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIAR    211 - 280
LPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHF    281 - 350
NDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVE    351 - 420
SKTK                                                                      421 - 424
//

Text Mined References (9)

PMID Year Title