Property Summary

NCBI Gene PubMed Count 24
PubMed Score 50.73
PubTator Score 33.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.752 2.3e-04
group 4 medulloblastoma 1.500 1.3e-03
atypical teratoid / rhabdoid tumor 1.100 3.2e-04
glioblastoma 1.100 3.3e-03
medulloblastoma, large-cell 1.900 7.6e-05
ovarian cancer 1.400 1.8e-06

Gene RIF (7)

PMID Text
26025128 genetic polymorphism is associated with bone mineral accretion in children with asthma receiving intermittent oral corticosteroids
20740604 Data show that bovine and human TBCD have functionally identical roles in tubulin heterodimer assembly, and that the inability of human TBCD to disrupt microtubule integrity can be overcome by siRNA-mediated suppression of expression of Arl2.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
18171676 Cofactor D functions as a centrosomal protein and is required for the recruitment of the gamma-tubulin ring complex at centrosomes and organization of the mitotic spindle
17704193 provides first evidence that beta-tubulin cofactor D plays a role in cells independent of its presumed role in folding tubulin heterodimers

AA Sequence

MALSDEPAAGGPEEEAEDETLAFGAALEAFGESAETRALLGRLREVHGGGAEREVALERFRVIMDKYQEQ      1 - 70
PHLLDPHLEWMMNLLLDIVQDQTSPASLVHLAFKFLYIITKVRGYKTFLRLFPHEVADVEPVLDLVTIQN     71 - 140
PKDHEAWETRYMLLLWLSVTCLIPFDFSRLDGNLLTQPGQARMSIMDRILQIAESYLIVSDKARDAAAVL    141 - 210
VSRFITRPDVKQSKMAEFLDWSLCNLARSSFQTMQGVITMDGTLQALAQIFKHGKREDCLPYAATVLRCL    211 - 280
DGCRLPESNQTLLRKLGVKLVQRLGLTFLKPKVAAWRYQRGCRSLAANLQLLTQGQSEQKPLILTEDDDE    281 - 350
DDDVPEGVERVIEQLLVGLKDKDTVVRWSAAKGIGRMAGRLPRALADDVVGSVLDCFSFQETDKAWHGGC    351 - 420
LALAELGRRGLLLPSRLVDVVAVILKALTYDEKRGACSVGTNVRDAACYVCWAFARAYEPQELKPFVTAI    421 - 490
SSALVIAAVFDRDINCRRAASAAFQENVGRQGTFPHGIDILTTADYFAVGNRSNCFLVISVFIAGFPEYT    491 - 560
QPMIDHLVTMKISHWDGVIRELAARALHNLAQQAPEFSATQVFPRLLSMTLSPDLHMRHGSILACAEVAY    561 - 630
ALYKLAAQENRPVTDHLDEQAVQGLKQIHQQLYDRQLYRGLGGQLMRQAVCVLIEKLSLSKMPFRGDTVI    631 - 700
DGWQWLINDTLRHLHLISSHSRQQMKDAAVSALAALCSEYYMKEPGEADPAIQEELITQYLAELRNPEEM    701 - 770
TRCGFSLALGALPGFLLKGRLQQVLTGLRAVTHTSPEDVSFAESRRDGLKAIARICQTVGVKAGAPDEAV    771 - 840
CGENVSQIYCALLGCMDDYTTDSRGDVGTWVRKAAMTSLMDLTLLLARSQPELIEAHTCERIMCCVAQQA    841 - 910
SEKIDRFRAHAASVFLTLLHFDSPPIPHVPHRGELEKLFPRSDVASVNWSAPSQAFPRITQLLGLPTYRY    911 - 980
HVLLGLVVSLGGLTESTIRHSTQSLFEYMKGIQSDPQALGSFSGTLLQIFEDNLLNERVSVPLLKTLDHV    981 - 1050
LTHGCFDIFTTEEDHPFAVKLLALCKKEIKNSKDIQKLLSGIAVFCEMVQFPGDVRRQALLQLCLLLCHR   1051 - 1120
FPLIRKTTASQVYETLLTYSDVVGADVLDEVVTVLSDTAWDAELAVVREQRNRLCDLLGVPRPQLVPQPG   1121 - 1190
AC                                                                       1191 - 1192
//

Text Mined References (28)

PMID Year Title
26025128 2015 Genetic risk factors for decreased bone mineral accretion in children with asthma receiving multiple oral corticosteroid bursts.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20740604 2010 Effect of TBCD and its regulatory interactor Arl2 on tubulin and microtubule integrity.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
18171676 2008 Cofactor D functions as a centrosomal protein and is required for the recruitment of the gamma-tubulin ring complex at centrosomes and organization of the mitotic spindle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17704193 2008 Beta-tubulin cofactor D and ARL2 take part in apical junctional complex disassembly and abrogate epithelial structure.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12912990 2003 Cytosolic Arl2 is complexed with cofactor D and protein phosphatase 2A.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11847227 2002 Functional overlap between retinitis pigmentosa 2 protein and the tubulin-specific chaperone cofactor C.
11110777 2000 Shear stress-dependent regulation of the human beta-tubulin folding cofactor D gene.
10831612 2000 ADP ribosylation factor-like protein 2 (Arl2) regulates the interaction of tubulin-folding cofactor D with native tubulin.
10722852 2000 Tubulin folding cofactor D is a microtubule destabilizing protein.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9265649 1997 Tubulin subunits exist in an activated conformational state generated and maintained by protein cofactors.
9110174 1997 Large-scale concatenation cDNA sequencing.
8706133 1996 Pathway leading to correctly folded beta-tubulin.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8567715 1996 Chaperonin-mediated folding of actin and tubulin.