Property Summary

NCBI Gene PubMed Count 21
PubMed Score 17.69
PubTator Score 13.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.719 1.1e-04
psoriasis 1.100 3.5e-04
tuberculosis 1.200 3.1e-09
lung cancer 1.300 1.2e-03
ovarian cancer 2.800 1.2e-07
pancreatic cancer 1.100 1.7e-02

Gene RIF (11)

PMID Text
25908846 the role of the human TBCE and TBCB chaperones in alpha-tubulin-beta-tubulin dissociation, was investigated.
25505242 results support a role for MAP1 proteins in promoting efficient retrograde trafficking of HIV-1 by stimulating the formation of stable microtubules and mediating the association of HIV-1 cores with microtubules.
25505242 CKAP1 protein interacts weakly with HIV-1 CA cores in primary human macrophages
22940919 TBCB localizes at spindle and midzone microtubules during mitosis.
22777741 Overexpression of TBCB leads to the decreased localization of p150 to the microtubule network that might result in a functional modulation of this protein complex.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19168853 Study demonstrates that, unlike its counterpart TBCE, TBCB only moderately destabilizes microtubules; neither TBCB abundance nor microtubule organization or densities are altered in giant axonal neuropathy mutant fibroblasts.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19038251 TBCB functions as a microtubule density regulator in microglia during activation, and provide an insight into understanding of mechanisms controlling microtubule reorganization during microglial transition between phenotypes.
18048340 These findings identified TCoB as the third cytoskeleton protein to be nitrated and suggest a previously undescribed mechanism, whereby growth factor signaling may coordinately integrate nitric oxide signaling in the regulation of microtubule dynamics.

AA Sequence

MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQE      1 - 70
DALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQ     71 - 140
QEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNG    141 - 210
KRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI                                        211 - 244
//

Text Mined References (27)

PMID Year Title
25908846 2015 The structure of the complex between ?-tubulin, TBCE and TBCB reveals a tubulin dimer dissociation mechanism.
25505242 2015 Microtubule-associated proteins 1 (MAP1) promote human immunodeficiency virus type I (HIV-1) intracytoplasmic routing to the nucleus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22940919 2013 Autoinhibition of TBCB regulates EB1-mediated microtubule dynamics.
22777741 2012 Tubulin-binding cofactor B is a direct interaction partner of the dynactin subunit p150(Glued).
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19168853 2009 Gigaxonin controls vimentin organization through a tubulin chaperone-independent pathway.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19038251 2009 Tubulin cofactor B regulates microtubule densities during microglia transition to the reactive states.
18048340 2007 Dynamic interplay between nitration and phosphorylation of tubulin cofactor B in the control of microtubule dynamics.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16303566 2005 Gigaxonin interacts with tubulin folding cofactor B and controls its degradation through the ubiquitin-proteasome pathway.
15831477 2005 p21-activated kinase 1 regulates microtubule dynamics by phosphorylating tubulin cofactor B.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9265649 1997 Tubulin subunits exist in an activated conformational state generated and maintained by protein cofactors.
8978780 1996 A complex satellite DNA polymorphism flanking the human ryanodine receptor gene (RYR1).
8978778 1996 Cloning, expression, and mapping of CKAPI, which encodes a putative cytoskeleton-associated protein containing a CAP-GLY domain.