Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.259 2.8e-02
adrenocortical carcinoma -1.272 3.6e-03
Astrocytoma, Pilocytic 1.200 6.4e-04
cystic fibrosis 1.470 4.5e-04
group 4 medulloblastoma 1.300 1.1e-04
intraductal papillary-mucinous adenoma (... 2.000 8.0e-05
intraductal papillary-mucinous carcinoma... 1.600 6.4e-04
intraductal papillary-mucinous neoplasm ... 1.300 7.2e-03
lung cancer -1.100 7.9e-03
lung carcinoma 1.200 7.4e-18
malignant mesothelioma -3.800 1.4e-08
medulloblastoma, large-cell 1.100 6.4e-04
osteosarcoma 1.764 2.6e-03
ovarian cancer -1.100 1.0e-07

AA Sequence

MWLKPEEVLLKNALKLWLMERSNDYFVLQRRRGYGEEGGGGLTGLLVGTLDSVLDSTAKVAPFRILHQTP      1 - 70
DSQVYLSIACGANREEITKHWDWLEQNIMKTLSVFDSNEDITNFVQGKIRGLIAEEGKHCFAKEDDPEKF     71 - 140
REALLKFEKCFGLPEKEKLVTYYSCSYWKGRVPCQGWLYLSTNFLSFYSFLLGSEIKLIISWDEVSKLEK    141 - 210
TSNVILTESIHVCSQGENHYFSMFLHINQTYLLMEQLANYAIRRLFDKETFDNDPVLYNPLQITKRGLEN    211 - 280
RAHSEQFNAFFRLPKGESLKEVHECFLWVPFSHFNTHGKMCISENYICFASQDGNQCSVIIPLREVLAID    281 - 350
KTNDSSKSVIISIKGKTAFRFHEVKDFEQLVAKLRLRCGAASTQYHDISTELAISSESTEPSDNFEVQSL    351 - 420
TSQRECSKTVNTEALMTVFHPQNLETLNSKMLKEKMKEQSWKILFAECGRGVSMFRTKKTRDLVVRGIPE    421 - 490
TLRGELWMLFSGAVNDMATNPDYYTEVVEQSLGTCNLATEEIERDLRRSLPEHPAFQSDTGISALRRVLT    491 - 560
AYAYRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNRRIIGALVDQAVFEELIRDHLP    561 - 630
QLTEHMTDMTFFSSVSLSWFLTLFISVLPIESAVNVVDCFFYDGIKAILQLGLAILDYNLDKLLTCKDDA    631 - 700
EAVTALNRFFDNVTNKDSPLPSNVQQGSNVSDEKTSHTRVDITDLIRESNEKYGNIRYEDIHSMRCRNRL    701 - 770
YVIQTLEETTKQNVLRVVSQDVKLSLQELDELYVIFKKELFLSCYWCLGCPVLKHHDPSLPYLEQYQIDC    771 - 840
QQFRALYHLLSPWAHSANKDSLALWTFRLLDENSDCLINFKEFSSAIDIMYNGSFTEKLKLLFKLHIPPA    841 - 910
YTEVKSKDASKGDELSKEELLYFSQLHVSKPANEKEAESAKHSPEKGKGKIDIQAYLSQWQDELFKKEEN    911 - 980
IKDLPRMNQSQFIQFSKTLYNLFHEDPEEESLYQAIAVVTSLLLRMEEVGRKLHSPTSSAKGFSGTVCGS    981 - 1050
GGPSEEKTGSHLEKDPCSFREEPQWSFAFEQILASLLNEPALVRFFEKPIDVKAKLENARISQLRSRTKM   1051 - 1120
//

Text Mined References (9)

PMID Year Title