Property Summary

NCBI Gene PubMed Count 21
PubMed Score 3.64
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.400 3.5e-03
atypical teratoid / rhabdoid tumor 1.100 8.7e-04
Gaucher disease type 1 -1.500 4.6e-02
group 4 medulloblastoma 1.400 6.1e-03
medulloblastoma, large-cell 1.700 2.1e-05
oligodendroglioma 1.400 7.5e-03
osteosarcoma 1.355 1.1e-03
ovarian cancer -1.400 1.2e-09
psoriasis -1.300 2.3e-04
Rheumatoid arthritis 2.200 1.9e-05
tuberculosis 2.800 5.6e-10
Waldenstrons macroglobulinemia 1.342 1.0e-03

Gene RIF (4)

AA Sequence

MYHSLSETRHPLQPEEQEVGIDPLSSYSNKSGGDSNKNGRRTSSTLDSEGTFNSYRKEWEELFVNNNYLA      1 - 70
TIRQKGINGQLRSSRFRSICWKLFLCVLPQDKSQWISRIEELRAWYSNIKEIHITNPRKVVGQQDLMINN     71 - 140
PLSQDEGSLWNKFFQDKELRSMIEQDVKRTFPEMQFFQQENVRKILTDVLFCYARENEQLLYKQGMHELL    141 - 210
APIVFVLHCDHQAFLHASESAQPSEEMKTVLNPEYLEHDAYAVFSQLMETAEPWFSTFEHDGQKGKETLM    211 - 280
TPIPFARPQDLGPTIAIVTKVNQIQDHLLKKHDIELYMHLNRLEIAPQIYGLRWVRLLFGREFPLQDLLV    281 - 350
VWDALFADGLSLGLVDYIFVAMLLYIRDALISSNYQTCLGLLMHYPFIGDVHSLILKALFLRDPKRNPRP    351 - 420
VTYQFHPNLDYYKARGADLMNKSRTNAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSS    421 - 490
SSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSAT    491 - 560
KKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLE    561 - 630
KEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQAS    631 - 700
SETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASS    701 - 770
SNPSSSPDDDSSKDSGFTIVSPLDI                                                 771 - 795
//

Text Mined References (33)

PMID Year Title