Property Summary

NCBI Gene PubMed Count 44
PubMed Score 113.51
PubTator Score 82.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.016 5.0e-03
atypical teratoid / rhabdoid tumor -1.300 6.2e-03
Breast cancer -1.400 4.9e-08
breast carcinoma -1.100 3.1e-21
colon cancer 1.100 2.8e-04
dermatomyositis 1.400 7.1e-04
invasive ductal carcinoma -1.400 1.6e-03
osteosarcoma 1.035 2.2e-02
ovarian cancer -2.700 1.3e-06
Polycystic ovary syndrome 1.015 2.0e-02
psoriasis -1.100 1.3e-03

Gene RIF (28)

AA Sequence

MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMAEIRRRSQKPE      1 - 70
AGGCGAPAAREVILVLSAPFLRCVPAPGAGASGGTSPSATQPNPAVFIFEHKAQHISRFIHNSHDLTYFA     71 - 140
YLIKAQPDDPESQMACHVFRATDPSQVPDVISSIRQLSKAAMKEDAKPSKDNEDAFYNSQKFEVLYCGKV    141 - 210
TVTHKKAPSSLIDDCMEKFSLHEQQRLKIQGEQRGPDPGEDLADLEVVVPGSPGDCLPEEADGTDTHLGL    211 - 280
PAGASQPALTSSRVCFPERILEDSGFDEQQEFRSRCSSVTGVQRRVHEGSQKSQPRRRHASAPSHVQPSD    281 - 350
SEKNRTMLFQVGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQC    351 - 420
ASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVIQRHLSSLTDN    421 - 490
EQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHVHIGEGPSTISNSTIPENATSSGRFKLDILK    491 - 560
NKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSLASEKDYSPGDSPPGTPPASPPSSAWQTFPEED    561 - 630
SDSPQFRRRAHTFSHPPSSTKRKLNLQDGRAQGVRSPLLRQSSSEQCSNLSSVRRMYKESNSSSSLPSLH    631 - 700
TSFSAPSFTAPSFLKSFYQNSGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLSVGGTSVTPRRI    701 - 770
SWRQRIFLRVASPMNKSPSAMQQQDGLDRNELLPLSPLSPTMEEEPLVVFLSGEDDPEKIEERKKSKELR    771 - 840
SLWRKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGACQKEVLITWDKKLLNCRAKIRCDMED    841 - 910
IHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQHAILVDLGRTFPTHPYF    911 - 980
SVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMS    981 - 1050
LQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVA   1051 - 1120
LSLLSSQETLIMECESFENIVEFLKNTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESS   1121 - 1190
YSCEDSETLEKLERANSQLKRQNMDLLEKLQVAHTKIQALESNLENLLTRETKMKSLIRTLEQEKMAYQK   1191 - 1260
TVEQLRKLLPADALVNCDLLLRDLNCNPNNKAKIGNKP                                   1261 - 1298
//

Text Mined References (58)

PMID Year Title