Property Summary

NCBI Gene PubMed Count 14
PubMed Score 16.23
PubTator Score 12.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.574 4.5e-05
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
lung carcinoma -1.900 4.0e-31

Gene RIF (4)

PMID Text
23562278 Armus expression induces autophagosome accumulation in keratinocytes.
23285084 TBC1D2/Armus, a GAP of Rab7 GTPase, is reported as a novel target of miR-17.
20944657 Observational study of gene-disease association. (HuGE Navigator)
20583170 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCARSLEAVPKKLCGYLSKFGGKGPIRGWKSRWFF      1 - 70
YDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGIFEIKTPSRVITLKAATKQAMLYWLQQLQMK     71 - 140
RWEFHNSPPAPPATPDAALAGNGPVLHLELGQEEAELEEFLCPVKTPPGLVGVAAALQPFPALQNISLKH    141 - 210
LGTEIQNTMHNIRGNKQAQGTGHEPPGEDSPQSGEPQREEQPLASDASTPGREPEDSPKPAPKPSLTISF    211 - 280
AQKAKRQNNTFPFFSEGITRNRTAQEKVAALEQQVLMLTKELKSQKELVKILHKALEAAQQEKRASSAYL    281 - 350
AAAEDKDRLELVRHKVRQIAELGRRVEALEQERESLAHTASLREQQVQELQQHVQLLMDKNHAKQQVICK    351 - 420
LSEKVTQDFTHPPDQSPLRPDAANRDFLSQQGKIEHLKDDMEAYRTQNCFLNSEIHQVTKIWRKVAEKEK    421 - 490
ALLTKCAYLQARNCQVESKYLAGLRRLQEALGDEASECSELLRQLVQEALQWEAGEASSDSIELSPISKY    491 - 560
DEYGFLTVPDYEVEDLKLLAKIQALESRSHHLLGLEAVDRPLRERWAALGDLVPSAELKQLLRAGVPREH    561 - 630
RPRVWRWLVHLRVQHLHTPGCYQELLSRGQAREHPAARQIELDLNRTFPNNKHFTCPTSSFPDKLRRVLL    631 - 700
AFSWQNPTIGYCQGLNRLAAIALLVLEEEESAFWCLVAIVETIMPADYYCNTLTASQVDQRVLQDLLSEK    701 - 770
LPRLMAHLGQHHVDLSLVTFNWFLVVFADSLISNILLRVWDAFLYEGTKVVFRYALAIFKYNEKEILRLQ    771 - 840
NGLEIYQYLRFFTKTISNSRKLMNIAFNDMNPFRMKQLRQLRMVHRERLEAELRELEQLKAEYLERRASR    841 - 910
RRAVSEGCASEDEVEGEA                                                        911 - 928
//

Text Mined References (21)

PMID Year Title
23562278 2013 The TBC/RabGAP Armus coordinates Rac1 and Rab7 functions during autophagy.
23285084 2012 miR-17-5p regulates endocytic trafficking through targeting TBC1D2/Armus.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22354992 2012 Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.
21269460 2011 Initial characterization of the human central proteome.
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
20116244 2010 Armus is a Rac1 effector that inactivates Rab7 and regulates E-cadherin degradation.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11785977 2002 Serological cloning of PARIS-1: a new TBC domain-containing, immunogenic tumor antigen from a prostate cancer cell line.