Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.17

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 3.4e-08
cystic fibrosis 1696 3.7e-06
group 3 medulloblastoma 4104 4.1e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6


  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.636 3.7e-06
group 3 medulloblastoma 1.200 4.1e-06
malignant mesothelioma -2.400 3.4e-08

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

NLMEVTSLAAAEAVLADLSTLKVMPLLQIFLFATVT                                      491 - 526

Text Mined References (10)

PMID Year Title