Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.84
PubTator Score 2.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.100 1.3e-08
osteosarcoma 1.386 2.4e-03
astrocytoma 1.700 4.4e-03
glioblastoma 1.400 3.8e-02
colon cancer 1.300 1.3e-02
lung cancer 1.900 3.2e-04
adult high grade glioma -1.100 2.8e-04
sonic hedgehog group medulloblastoma 1.100 3.4e-04
invasive ductal carcinoma -1.100 1.9e-02
ovarian cancer 1.800 1.2e-05

Gene RIF (3)

PMID Text
26030178 RAB5C is identified as a new TBC1D16 target and showed that it regulates EGFR in melanoma cells.
23019362 TBC1D16 is a GTPase activating protein for Rab4A that regulates transferrin receptor recycling and EGFR trafficking and signaling.
21129771 TBC1D16 and RAB27A, were identified known drivers of melanoma both are involved in the regulation of vesicular trafficking, which highlights this process as important for proliferation in melanoma.

AA Sequence

MSLGRLLRRASSKASDLLTLTPGGSGSGSPSVLDGEIIYSKNNVCVHPPEGLQGLGEHHPGYLCLYMEKD      1 - 70
EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSGASHQPSPTELRPTLTPKDED     71 - 140
ILVVAQSVPDRMLASPAPEDEEKLAQGLGVDGAQPASQPACSPSGILSTVSPQDVTEEGREPRPEAGEED    141 - 210
GSLELSAEGVSRDSSFDSDSDTFSSPFCLSPISAALAESRGSVFLESDSSPPSSSDAGLRFPDSNGLLQT    211 - 280
PRWDEPQRVCALEQICGVFRVDLGHMRSLRLFFSDEACTSGQLVVASRESQYKVFHFHHGGLDKLSDVFQ    281 - 350
QWKYCTEMQLKDQQVAPDKTCMQFSIRRPKLPSSETHPEESMYKRLGVSAWLNHLNELGQVEEEYKLRKA    351 - 420
IFFGGIDVSIRGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAFWRNVQFTVDK    421 - 490
DVVRTDRNNQFFRGEDNPNVESMRRILLNYAVYNPAVGYSQGMSDLVAPILAEVLDESDTFWCFVGLMQN    491 - 560
TIFVSSPRDEDMEKQLLYLRELLRLTHVRFYQHLVSLGEDGLQMLFCHRWLLLCFKREFPEAEALRIWEA    561 - 630
CWAHYQTDYFHLFICVAIVAIYGDDVIEQQLATDQMLLHFGNLAMHMNGELVLRKARSLLYQFRLLPRIP    631 - 700
CSLHDLCKLCGSGMWDSGSMPAVECTGHHPGSESCPYGGTVEMPSPKSLREGKKGPKTPQDGFGFRR       701 - 767
//

Text Mined References (11)

PMID Year Title
26030178 2015 Epigenetic activation of a cryptic TBC1D16 transcript enhances melanoma progression by targeting EGFR.
23019362 2012 TBC1D16 is a Rab4A GTPase activating protein that regulates receptor recycling and EGF receptor signaling.
22354992 2012 Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.
21129771 2010 An integrated approach to uncover drivers of cancer.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.