Property Summary

NCBI Gene PubMed Count 36
PubMed Score 57.31
PubTator Score 39.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.021 1.1e-02
astrocytoma 1.300 3.4e-03
diabetes mellitus -1.300 6.0e-03
gastric carcinoma 1.500 2.8e-03
glioblastoma 1.200 2.3e-03
interstitial cystitis -1.100 8.1e-03
lung adenocarcinoma -1.300 2.2e-11
lung cancer 2.100 4.6e-04
lung carcinoma -1.200 7.4e-16
malignant mesothelioma -2.000 4.3e-06
non-small cell lung cancer -1.238 2.7e-20
osteosarcoma -1.150 2.5e-03
ovarian cancer -1.400 1.7e-07
posterior fossa group A ependymoma 1.100 3.1e-08
sonic hedgehog group medulloblastoma 1.300 3.3e-06
subependymal giant cell astrocytoma 1.921 9.6e-03
tuberculosis 1.100 8.0e-06
Waldenstrons macroglobulinemia 1.048 1.0e-02

Gene RIF (19)

AA Sequence

MEPITFTARKHLLSNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSTRKEPVTKQVRLCVSP      1 - 70
SGLRCEPEPGRSQQWDPLIYSSIFECKPQRVHKLIHNSHDPSYFACLIKEDAVHRQSICYVFKADDQTKV     71 - 140
PEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGRVTVAHKKAPPALIDECIEKFNHVSGSRGSE    141 - 210
SPRPNPPHAAPTGSQEPVRRPMRKSFSQPGLRSLAFRKELQDGGLRSSGFFSSFEESDIENHLISGHNIV    211 - 280
QPTDIEENRTMLFTIGQSEVYLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCY    281 - 350
VFQCTNEALVDEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQSLHKLCERIEGMNSSKTKLELQKHLTT    351 - 420
LTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIGEMKQTSQMAAENIGSELPPSATR    421 - 490
FRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSISVDLDSSLSSTLSNTSKEPSVCEKEALPISESSF    491 - 560
KLLGSSEDLSSDSESHLPEEPAPLSPQQAFRRRANTLSHFPIECQEPPQPARGSPGVSQRKLMRYHSVST    561 - 630
ETPHERKDFESKANHLGDSGGTPVKTRRHSWRQQIFLRVATPQKACDSSSRYEDYSELGELPPRSPLEPV    631 - 700
CEDGPFGPPPEEKKRTSRELRELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEV    701 - 770
TTVWEKMLSTPGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVPYKELLKQ    771 - 840
LTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMSEEEAF    841 - 910
KMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTMFASQFPL    911 - 980
GFVARVFDMIFLQGTEVIFKVALSLLGSHKPLILQHENLETIVDFIKSTLPNLGLVQMEKTINQVFEMDI    981 - 1050
AKQLQAYEVEYHVLQEELIDSSPLSDNQRMDKLEKTNSSLRKQNLDLLEQLQVANGRIQSLEATIEKLLS   1051 - 1120
SESKLKQAMLTLELERSALLQTVEELRRRSAEPSDREPECTQPEPTGD                         1121 - 1168
//

Text Mined References (39)

PMID Year Title