Property Summary

NCBI Gene PubMed Count 11
PubMed Score 279.24
PubTator Score 11.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6514 4.5e-34
Disease Target Count Z-score Confidence
Prion disease 16 0.0 0.9
Disease Target Count
Hirschsprung disease 1 8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.500 4.5e-34

Gene RIF (7)

AA Sequence

MATDVQLADYPLMSPKAELKLEKKSGRKPRSPRDSGPQKELVIPGIVDFERIRRALRTPKPQTPGTYCFG      1 - 70
RLSHHSFFSRHHPHPQHVTHIQDLTGKPVCVVRDFPAPLPESTVFSGCQMGIPTISVPIGDPQSNRNPQL     71 - 140
SSEAWKKELKELASRVAFLTKEDELKKKEKEQKEEPLREQGAKYSAETGRLIPASTRAVGRRRSHQGQQS    141 - 210
QSSSRHEGVQAFLLQDQELLVLELLCRILETDLLSAIQFWLLYAPPKEKDLALGLLQTAVAQLLPQPLVS    211 - 280
IPTEKLLSQLPEVHEPPQEKQEPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAE    281 - 350
S//

Text Mined References (12)

PMID Year Title