Property Summary

NCBI Gene PubMed Count 43
PubMed Score 28.72
PubTator Score 15.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.691 1.2e-05
psoriasis -1.100 3.9e-08
osteosarcoma -1.256 3.0e-02
juvenile dermatomyositis 1.052 2.3e-10
acute quadriplegic myopathy 1.157 5.0e-05
intraductal papillary-mucinous carcinoma... 1.200 4.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.6e-02
spina bifida -1.219 4.2e-02
ovarian cancer -1.200 1.9e-05
dermatomyositis 1.100 7.1e-04

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26451915 we demonstrate that myosin VI and TAX1BP1 are recruited to ubiquitylated Salmonella and play a key role in xenophagy
26287441 The induction of antibodies to an AQP4 epitope in mice immunized with the TAX1BP1-derived peptide suggests that a latent HTLV-1 infection could lead to TAX1BP1 antigen presentation and the production of anti-AQP4 antibodies in human neuromyelitis optica.
24817723 A protein construct corresponding to the SKICH domain plus the linker region was expressed, purified and crystallized for TAX1BP1.
23308279 RNF11 functions together with TAX1BP1 to restrict antiviral signaling and IFN-beta production.
23209807 Autophagy of Tax1bp1/Ndp52 promotes non-canonical NF-kappaB signalling.
22997707 Allele frequencies of three Alu insertions that are located in MEF2C (two of them) and TAX1BP1 genes significantly differ between cohorts of healthy donors and ALL(acute lymphoblastic leukemia) patients.
21885437 ABIN1 requires its ubiquitin binding domain and cooperates with TAX1BP1 and A20 to restrict antiviral signaling.
21282516 In a link with T cell leukemia virus-1-associated myelopathy/tropical spastic paraparesis, an alphabeta T cell receptor recognizes a self peptide from neuronal protein HuD in context of histocompatibility antigen HLA-A2.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20549079 There is evidence of the association between the TAX1BP1 polymorphism and oral cavity cancer but there are no differences in the distribution of the polymorphism among patients with head and neck cancer and individuals without history of neoplasm.
20549079 Observational study of gene-disease association. (HuGE Navigator)
20304918 results demonstrate TBK1-IKKi to be novel substrates for A20 and further identify a novel mechanism whereby A20 and TAX1BP1 restrict antiviral signaling by disrupting a TRAF3-TBK1-IKKi signaling complex
18434448 Observational study of gene-disease association. (HuGE Navigator)
17635994 myosin VI-T6BP interactions may link membrane trafficking pathways with cell adhesion and cytokine-dependent cell signalling.

AA Sequence

MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSP      1 - 70
MPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDM     71 - 140
LVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKGLTEVT    141 - 210
QSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEK    211 - 280
ELYKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKEDTC    281 - 350
FLKEQLRKAEEQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENEKVKKQLADAVAELKLNAMKKD    351 - 420
QDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDA    421 - 490
SVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELA    491 - 560
KMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAERKMEGQNSQSPQCFKTCSEQNGYVLTLSNAQ    561 - 630
PVLQYGNPYASQETRDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENV    631 - 700
PTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQ    701 - 770
QVFERHVQTHFDQNVLNFD                                                       771 - 789
//

Text Mined References (49)

PMID Year Title
26451915 2015 The Autophagy Receptor TAX1BP1 and the Molecular Motor Myosin VI Are Required for Clearance of Salmonella Typhimurium by Autophagy.
26287441 2015 Immunization of mice with a peptide derived from the HTLV-1 TAX1BP1 protein induces cross-reactive antibodies against aquaporin 4.
25416956 2014 A proteome-scale map of the human interactome network.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24817723 2014 Expression, purification and crystallization of the SKICH domain of human TAX1BP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239949 2014 The structure of TAX1BP1 UBZ1+2 provides insight into target specificity and adaptability.
23308279 2013 RING finger protein 11 targets TBK1/IKKi kinases to inhibit antiviral signaling.
23209807 2012 TBK1 kinase addiction in lung cancer cells is mediated via autophagy of Tax1bp1/Ndp52 and non-canonical NF-?B signalling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22997707 [The functional analysis of polymorphic insertions of Alu retroelements at acute lymphoblastic leukemia].
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21885437 2011 ABIN1 protein cooperates with TAX1BP1 and A20 proteins to inhibit antiviral signaling.
21765415 2011 The kinase IKK? inhibits activation of the transcription factor NF-?B by phosphorylating the regulatory molecule TAX1BP1.
21282516 2011 Conformational melding permits a conserved binding geometry in TCR recognition of foreign and self molecular mimics.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20549079 Analysis of the TAX1BP1 gene in head and neck cancer patients.
20304918 2010 TAX1BP1 and A20 inhibit antiviral signaling by targeting TBK1-IKKi kinases.
20185725 2010 Inhibition of NF-kappaB signaling by A20 through disruption of ubiquitin enzyme complexes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19131965 2009 The ubiquitin-editing enzyme A20 requires RNF11 to downregulate NF-kappaB signalling.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18434448 2009 Genetic variation in the nuclear factor kappaB pathway in relation to susceptibility to rheumatoid arthritis.
18246070 2008 The E3 ligase Itch negatively regulates inflammatory signaling pathways by controlling the function of the ubiquitin-editing enzyme A20.
18239685 2008 Inflammatory cardiac valvulitis in TAX1BP1-deficient mice through selective NF-kappaB activation.
17703191 2007 Essential role for TAX1BP1 in the termination of TNF-alpha-, IL-1- and LPS-mediated NF-kappaB and JNK signaling.
17635994 2007 T6BP and NDP52 are myosin VI binding partners with potential roles in cytokine signalling and cell adhesion.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474016 2004 A20 is a potent inhibitor of TLR3- and Sendai virus-induced activation of NF-kappaB and ISRE and IFN-beta promoter.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697242 2004 Chromosome 13q12 encoded Rho GTPase activating protein suppresses growth of breast carcinoma cells, and yeast two-hybrid screen shows its interaction with several proteins.
14530271 2004 Protein profile of tax-associated complexes.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11893730 2002 Heterogeneous nuclear ribonucleoprotein A1 interferes with the binding of the human T cell leukemia virus type 1 rex regulatory protein to its response element.
11389905 2001 Functional redundancy of the zinc fingers of A20 for inhibition of NF-kappaB activation and protein-protein interactions.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10920205 2000 T6BP, a TRAF6-interacting protein involved in IL-1 signaling.
10435631 1999 The zinc finger protein A20 interacts with a novel anti-apoptotic protein which is cleaved by specific caspases.
9847074 1998 Toward a complete human genome sequence.
9733879 1998 CREB-2, a cellular CRE-dependent transcription repressor, functions in association with Tax as an activator of the human T-cell leukemia virus type 1 promoter.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.