Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.13
PubTator Score 16.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.3e-03
medulloblastoma, large-cell 6234 5.8e-03
lung cancer 4473 7.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 5.8e-03
lung cancer 1.800 7.4e-03
ovarian cancer 1.800 2.3e-03

Pathway (1)

Gene RIF (9)

PMID Text
26137584 simultaneous expression of the leukemogenic AF4-MLL and dnTASP1 causes the disappearance of the leukemogenic oncoprotein, because the uncleaved AF4-MLL protein (328 kDa) is subject to proteasomal degradation.
25996597 Our results provide first evidence that Taspase1 processing affects TFIIA regulation of TFIID and suggest that Taspase1 processing of TFIIA is required to establish INR-selective core promoter activity in the presence of NC2.
22570686 inefficient heterodimerization appears to be the mechanism by which inactive Taspase1 variants fail to inhibit wild type Taspase1's activity in trans.
21418451 Taspase1 appears to exploit the nuclear export activity of importin-alpha/nucleophosmin to gain transient access to the cytoplasm required to also cleave its cytoplasmic substrates.
21084304 Cell-based analysis of structure-function activity of threonine aspartase 1.
20516119 Taspase1 is overexpressed in primary human cancers, and deficiency of Taspase1 in cancer cells not only disrupts proliferation but also enhances apoptosis.
18395097 TASP1, EPS15R, and PRPF3 expression were significantly induced in HCCs of transgenic EGF2B mice as was P2 promoter-driven HNF4alpha
16537915 Transfected taspase 1 enhances cleavage of TFIIA, and RNA interference knockdown of endogenous taspase 1 diminishes cleavage of TFIIA in vivo.
14636557 purification and cloning of threonine aspartase 1 responsible for cleaving MLL; RNAi-mediated knockdown of Taspase1 results in the appearance of unprocessed MLL and the loss of proper HOX gene expression

AA Sequence

MTMEKGMSSGEGLPSRSSQVSAGKITAKELETKQSYKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQ      1 - 70
KAIEKLQAGALATDAVTAALVELEDSPFTNAGMGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPV     71 - 140
SVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPNIMTTRFSLAAFKRNKRKLELAERVD    141 - 210
TDFMQLKKRRQSSEKENDSGTLDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGA    211 - 280
HNPYSTAVSTSGCGEHLVRTILARECSHALQAEDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCR    281 - 350
CSAEPDSSQNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN    351 - 420
//

Text Mined References (17)

PMID Year Title
27308523 Taspase 1: A protease with many biological surprises.
26137584 2015 Unraveling the Activation Mechanism of Taspase1 which Controls the Oncogenic AF4-MLL Fusion Protein.
25996597 2015 Taspase1 processing alters TFIIA cofactor properties in the regulation of TFIID.
22829979 2012 Chemico-genetic strategies to inhibit the leukemic potential of threonine aspartase-1.
22570686 2012 Overexpression of the catalytically impaired Taspase1 T234V or Taspase1 D233A variants does not have a dominant negative effect in T(4;11) leukemia cells.
21418451 2011 The importin-alpha/nucleophosmin switch controls taspase1 protease function.
21084304 2011 Cell-based analysis of structure-function activity of threonine aspartase 1.
20516119 2010 Taspase1 functions as a non-oncogene addiction protease that coordinates cancer cell proliferation and apoptosis.
18395097 2008 EPS15R, TASP1, and PRPF3 are novel disease candidate genes targeted by HNF4alpha splice variants in hepatocellular carcinomas.
16537915 2006 Uncleaved TFIIA is a substrate for taspase 1 and active in transcription.
16216576 2005 Crystal structure of human Taspase1, a crucial protease regulating the function of MLL.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14636557 2003 Taspase1: a threonine aspartase required for cleavage of MLL and proper HOX gene expression.
12482972 2003 Proteolytic cleavage of MLL generates a complex of N- and C-terminal fragments that confers protein stability and subnuclear localization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.