Property Summary

Ligand Count 1
NCBI Gene PubMed Count 18
PubMed Score 7.13
PubTator Score 16.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 4.6e-03
medulloblastoma, large-cell 6241 5.8e-03
lung cancer 4740 7.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 1.0

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.800 7.4e-03
medulloblastoma, large-cell -1.100 5.8e-03
ovarian cancer -1.100 4.6e-03

Gene RIF (10)

AA Sequence

MTMEKGMSSGEGLPSRSSQVSAGKITAKELETKQSYKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQ      1 - 70
KAIEKLQAGALATDAVTAALVELEDSPFTNAGMGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPV     71 - 140
SVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPNIMTTRFSLAAFKRNKRKLELAERVD    141 - 210
TDFMQLKKRRQSSEKENDSGTLDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGA    211 - 280
HNPYSTAVSTSGCGEHLVRTILARECSHALQAEDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCR    281 - 350
CSAEPDSSQNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN    351 - 420
//

Text Mined References (18)

PMID Year Title