Property Summary

Ligand Count 1
NCBI Gene PubMed Count 17
PubMed Score 6.94
PubTator Score 7.77

Knowledge Summary

Patent (6,978)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.1e-04

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 3.1e-04

Gene RIF (5)

AA Sequence

MTTFIPIIFSSVVVVLFVIGNFANGFIALVNSIERVKRQKISFADQILTALAVSRVGLLWVLLLNWYSTV      1 - 70
FNPAFYSVEVRTTAYNVWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLHLKRRVKSVILVMLLGPLLFL     71 - 140
ACQLFVINMKEIVRTKEYEGNLTWKIKLRSAVYLSDATVTTLGNLVPFTLTLLCFLLLICSLCKHLKKMQ    141 - 210
LHGKGSQDPSTKVHIKALQTVIFFLLLCAVYFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILI    211 - 280
WGNKKLKQTFLSVLRQVRYWVKGEKPSSP                                             281 - 309
//

Text Mined References (18)

PMID Year Title