Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.94
PubTator Score 7.77

Knowledge Summary

Patent (6,978)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 3.1e-04

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 3.1e-04

Gene RIF (5)

PMID Text
26024668 Genotypes for the Val240Ile (rs10772423) SNP in TAS2R31 remains significant at a Bonferroni corrected alpha of 0.025.
21672920 Haplotype analyses revealed that most associations were spurious, arising from LD with variants in TAS2R31.
17702579 hT2R43 gene allele makes people more sensitive to the bitterness of an artificial sweetener, saccharin; in addition, a closely related gene's (hT2R44's) allele also makes people more sensitive to the bitterness of saccharin.
15537898 hTAS2R43 and hTAS2R44 function as cognate bitter taste receptors and do not contribute to the sweet taste of saccharin and acesulfame K.
15337684 Activation by denatonium and 6-nitrosaccharin.

AA Sequence

MTTFIPIIFSSVVVVLFVIGNFANGFIALVNSIERVKRQKISFADQILTALAVSRVGLLWVLLLNWYSTV      1 - 70
FNPAFYSVEVRTTAYNVWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLHLKRRVKSVILVMLLGPLLFL     71 - 140
ACQLFVINMKEIVRTKEYEGNLTWKIKLRSAVYLSDATVTTLGNLVPFTLTLLCFLLLICSLCKHLKKMQ    141 - 210
LHGKGSQDPSTKVHIKALQTVIFFLLLCAVYFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILI    211 - 280
WGNKKLKQTFLSVLRQVRYWVKGEKPSSP                                             281 - 309
//

Text Mined References (18)

PMID Year Title
26024668 2015 Quinine Bitterness and Grapefruit Liking Associate with Allelic Variants in TAS2R31.
24187601 2013 Rebaudioside A and Rebaudioside D bitterness do not covary with Acesulfame K bitterness or polymorphisms in TAS2R9 and TAS2R31.
23878414 2013 Do polymorphisms in chemosensory genes matter for human ingestive behavior?
23599216 2013 Bitterness of the non-nutritive sweetener acesulfame potassium varies with polymorphisms in TAS2R9 and TAS2R31.
21672920 2011 Genomic, genetic and functional dissection of bitter taste responses to artificial sweeteners.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
17702579 2007 Specific alleles of bitter receptor genes influence human sensitivity to the bitterness of aloin and saccharin.
16541075 2006 The finished DNA sequence of human chromosome 12.
15537898 2004 Bitter taste receptors for saccharin and acesulfame K.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15337684 2004 Identification of ligands for two human bitter T2R receptors.
12584440 2002 Identification and characterization of human taste receptor genes belonging to the TAS2R family.
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379855 2002 The human TAS2R16 receptor mediates bitter taste in response to beta-glucopyranosides.
12139982 2002 Receptors for bitter and sweet taste.
11696554 2002 Molecular mechanisms of bitter and sweet taste transduction.