Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.92
PubTator Score 0.90

Knowledge Summary

Patent (1,870)

Expression

AA Sequence

MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLWVLLLHWYATQ      1 - 70
LNPAFYSVEVRITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLRIKRRVKSVVLVILLGPLLFL     71 - 140
VCHLFVINMDETVWTKEYEGNVTWKIKLRSAMYHSNMTLTMLANFVPLTLTLISFLLLICSLCKHLKKMQ    141 - 210
LHGKGSQDPSTKVHIKALQTVTSFLLLCAIYFLSMIISVCNFGRLEKQPVFMFCQAIIFSYPSTHPFILI    211 - 280
LGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRGALCVF                                   281 - 319
//

Text Mined References (8)

PMID Year Title